ESTScan Details for Unigene SGN-U585463

Score 
64
Direction 
Forward
Predicted Peptide Sequence 
XVEPVIQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDTLMSKNGLYXPPDATSLWEGIAVNIDLFKNGSNATEGHL
IYSNXPNPYCKIPASNWTDQSKDRMMRISNTLFAVDYHVWAVKLRXVIXTDGVVVQIDIEDDRMSGLEPYSFGGRPVV*
Predicted Coding Sequence 
XXGGTCGAGCCGGTGATACAGGAGGCTCTTGATACTCTAATCATGGGGAACAAGACAACTATTTTAATTGCCCACCGAGCTGCCATGATG
AGGCATGTTGACAACATAGTTGTACTTAATGGAGGGAGGATTGTTGAGGAAGGTACCCACGATACACTGATGTCAAAAAATGGTTTGTAT
GXTCCGCCTGATGCAACCTCACTTTGGGAAGGGATTGCXGTCAACATAGACTTGTTTAAAAACGGAAGCAATGCAACTGAAGGACATCTC
ATTTACAGTAACXGTCCAAATCCTTACTGTAAAATCCCAGCTTCAAACTGGACAGATCAAAGCAAAGACAGAATGATGAGGATTTCTAAC
ACTTTGTTTGCTGTTGATTATCACGTTTGGGCAGTGAAACTTCGTXATGTAATTAGXACTGATGGCGTTGTTGTTCAAATTGATATCGAG
GATGATAGGATGTCAGGACTAGAACCCTATTCTTTTGGAGGCAGGCCGGTTGTGTAG
Edits in Original Sequence 
(5')XXGGTCGAGCCGaGTGATACAGGAGGCTCTTGATACTCTAATCATGGGGAACAAGACAACTATTTTAATTGCCCACCGAGCTGCCA
TGATGAGGCATGTTGACAACATAGTTGTACTTAATGGAGGGAGGATTGTTGAGGAAGGTACCCACGATACACTGATGTCAAAAAATGGTT
TGTATGXTCCGCCTGATGCAACCTCACTTTGGGAAGGGATTGCXGTCAACATAGACTTGTTTAAAAACGGAAGCAATGCAACTGAAGGtA
CATCTCATTTACAGTAACXGTCCAAATCCTTACTGTAAAATCCCAGCTTCAAACTGGACAGATCAAAGCAAAGACAGAATGATGAGGATT
TCTAACACTTTGTTTGCTGTTGATTATCACGTTTGGGCAGTGAAACTTCGTXATGTAATTAGXACTGATGGCGTTGTTGTTCAAATTGAT
ATCGAGGATGATAGGATGTCAGGACTAGAACCCTATTCTTTTGGAGGCAGGCCGGTTGTGTAG(3')ATCAGGTTTATGCTCCGTCTCCT
GATGGTATATTGATTTGTTAATTATAGAGTGGAATGAGTAGCCATAGCTTTGATCAGGTCTGTATTCTTTCTTCCTTTCGGGTTGTGTCT
CTGTGTGTGTTGTAGTCAAGTCAAGTGATGTTCATTTTTTTCGTGACGAAAAATCCCCCTCTCCACTTTTCTGCTGTATATTTTTCTTAT
ATGGAAGCCATAAGAGATGATTTCACCATC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan