ESTScan Details for Unigene SGN-U585524

Score 
1155
Direction 
Forward
Predicted Peptide Sequence 
XLIEKQLEREVLNNELPLQSEVDQHEVKEKSDGLIEKQMEREILNNDPIKSEVDQHEGKKESDGLIEKQMEREILNNELPIQPEDQEGGD
SASLFDEQTPDSTANTDYDDESLPVSLSQDLGHVSLDDSNQLGHFKLDSNENNIIQQADEVSPTVSEYPEGLNSVDVPVDQGVSLASTSD
GWPAISIAASYGCATPISHEYSSAEELSLGHPRVTEERVASLINLEAVPTGKDAGRDMLSREPSAISLFGSYPQNRNEIFHPFFKDPDSS
SYNREQRQSPLDFQPATNLMVQQSQYSGHFREQLHVQLPIELRHKGLNDLLMHQNFQGNLYTDGSRYSFPRHEQLNVGIQDWAVNSVHVS
TPPQTHLSSGDLLNQNWISGENHARGSWCTLGGVGGPSQSIGSVNNSDQSLYSVLSECNALHQSGSYNVSGSRERLIPSRNYGEMGVGVP
TTSNASQQQAVSLSYTSSQESPSGLKPNGLGWTSMSTQNPGRYHDSMGKPFLGPGIHRDVVLHKATRIVGTIIDVNFYILHHKM*
Predicted Coding Sequence 
XGGTTGATCGAGAAGCAACTTGAAAGAGAAGTACTAAATAATGAGCTTCCTCTACAGTCAGAGGTTGATCAGCATGAGGTCAAGGAAAAA
TCTGATGGGTTGATCGAGAAGCAAATGGAAAGAGAAATTCTGAATAATGATCCTATAAAGTCAGAGGTTGATCAGCATGAGGGCAAGAAA
GAATCTGATGGGTTGATCGAGAAGCAAATGGAAAGAGAAATACTAAATAATGAGCTTCCTATACAGCCAGAGGATCAGGAGGGAGGAGAT
TCTGCAAGCTTATTTGATGAACAAACTCCTGATAGCACAGCTAACACTGATTACGATGACGAGTCTCTCCCCGTCTCACTCAGTCAGGAT
CTTGGTCATGTTTCACTTGATGATAGCAATCAGTTAGGTCACTTTAAGCTGGATTCTAATGAGAACAATATAATCCAGCAGGCAGATGAA
GTTTCCCCAACTGTATCAGAGTATCCAGAAGGGTTGAATAGTGTAGATGTTCCTGTTGATCAAGGGGTTTCTCTTGCTTCTACCAGTGAT
GGTTGGCCAGCAATTAGCATAGCTGCCTCTTATGGGTGTGCCACTCCCATAAGTCATGAATATTCTTCTGCCGAGGAGTTGTCACTAGGG
CATCCTCGAGTGACTGAGGAGAGAGTCGCTAGTCTTATTAATCTGGAAGCTGTCCCAACAGGAAAGGATGCTGGGAGGGATATGTTGTCC
AGAGAACCCAGTGCCATTTCTCTTTTTGGTTCATACCCTCAGAACAGGAACGAAATATTCCACCCATTTTTCAAGGATCCAGATAGTTCA
TCTTACAACCGTGAGCAGAGACAGTCTCCTCTGGACTTCCAACCAGCAACCAATCTGATGGTGCAGCAAAGTCAATATTCTGGTCATTTT
AGGGAGCAGCTTCATGTGCAGTTACCAATTGAGCTACGACACAAGGGGCTGAATGATCTCCTCATGCATCAGAACTTTCAGGGGAATCTG
TACACAGATGGAAGTCGATATTCTTTCCCTAGGCATGAACAGTTGAATGTTGGCATTCAAGATTGGGCCGTCAATTCTGTTCATGTGTCG
ACACCGCCTCAAACTCATCTAAGCAGTGGAGACTTGTTAAATCAGAATTGGATCTCTGGAGAGAATCATGCCCGTGGGAGCTGGTGTACT
TTAGGAGGTGTTGGTGGTCCATCTCAGAGCATTGGAAGCGTAAACAACTCAGATCAGAGCTTGTACAGTGTTTTATCTGAGTGCAACGCA
CTGCATCAAAGTGGCTCTTATAATGTATCAGGTTCAAGAGAACGGTTGATCCCTTCAAGGAACTATGGTGAGATGGGCGTGGGAGTTCCC
ACAACGAGCAATGCCTCACAGCAGCAAGCTGTTTCCCTTAGTTACACGAGTAGCCAGGAAAGTCCTAGCGGCCTTAAACCCAATGGTCTT
GGATGGACGAGCATGTCTACTCAGAATCCGGGCAGGTACCATGATTCGATGGGCAAACCATTCTTGGGCCCTGGAATCCATAGGGATGTT
GTCTTGCACAAGGCTACAAGAATCGTCGGGACAATAATTGATGTAAATTTTTACATTTTACACCACAAGATGTAG
Edits in Original Sequence 
(5')XGGTTGATCGAGAAGCAACTTGAAAGAGAAGTACTAAATAATGAGCTTCCTCTACAGTCAGAGGTTGATCAGCATGAGGTCAAGGA
AAAATCTGATGGGTTGATCGAGAAGCAAATGGAAAGAGAAATTCTGAATAATGATCCTATAAAGTCAGAGGTTGATCAGCATGAGGGCAA
GAAAGAATCTGATGGGTTGATCGAGAAGCAAATGGAAAGAGAAATACTAAATAATGAGCTTCCTATACAGCCAGAGGATCAGGAGGGAGG
AGATTCTGCAAGCTTATTTGATGAACAAACTCCTGATAGCACAGCTAACACTGATTACGATGACGAGTCTCTCCCCGTCTCACTCAGTCA
GGATCTTGGTCATGTTTCACTTGATGATAGCAATCAGTTAGGTCACTTTAAGCTGGATTCTAATGAGAACAATATAATCCAGCAGGCAGA
TGAAGTTTCCCCAACTGTATCAGAGTATCCAGAAGGGTTGAATAGTGTAGATGTTCCTGTTGATCAAGGGGTTTCTCTTGCTTCTACCAG
TGATGGTTGGCCAGCAATTAGCATAGCTGCCTCTTATGGGTGTGCCACTCCCATAAGTCATGAATATTCTTCTGCCGAGGAGTTGTCACT
AGGGCATCCTCGAGTGACTGAGGAGAGAGTCGCTAGTCTTATTAATCTGGAAGCTGTCCCAACAGGAAAGGATGCTGGGAGGGATATGTT
GTCCAGAGAACCCAGTGCCATTTCTCTTTTTGGTTCATACCCTCAGAACAGGAACGAAATATTCCACCCATTTTTCAAGGATCCAGATAG
TTCATCTTACAACCGTGAGCAGAGACAGTCTCCTCTGGACTTCCAACCAGCAACCAATCTGATGGTGCAGCAAAGTCAATATTCTGGTCA
TTTTAGGGAGCAGCTTCATGTGCAGTTACCAATTGAGCTACGACACAAGGGGCTGAATGATCTCCTCATGCATCAGAACTTTCAGGGGAA
TCTGTACACAGATGGAAGTCGATATTCTTTCCCTAGGCATGAACAGTTGAATGTTGGCATTCAAGATTGGGCCGTCAATTCTGTTCATGT
GTCGACACCGCCTCAAACTCATCTAAGCAGTGGAGACTTGTTAAATCAGAATTGGATCTCTGGAGAGAATCATGCCCGTGGGAGCTGGTG
TACTTTAGGAGGTGTTGGTGGTCCATCTCAGAGCATTGGAAGCGTAAACAACTCAGATCAGAGCTTGTACAGTGTTTTATCTGAGTGCAA
CGCACTGCATCAAAGTGGCTCTTATAATGTATCAGGTTCAAGAGAACGGTTGATCCCTTCAAGGAACTATGGTGAGATGGGCGTGGGAGT
TCCCACAACGAGCAATGCCTCACAGCAGCAAGCTGTTTCCCTTAGTTACACGAGTAGCCAGGAAAGTCCTAGCGGCCTTAAACCCAATGG
TCTTGGATGGACGAGCATGTCTACTCAGAATCCGGGCAGGTACCATGATTCGATGGGCAAACCATTCTTGaGGCCCTGGAATCCATAGGG
ATGTTGTCTTGCACAAGGCTACAAGAATCGTCGGGACAATAATTGATGTAAATTTTTACATTTTACACCACAAGATGTAG(3')GCGGCT
ATGGTAATGCAGCCGGACTTTGTTGCAATTGTTTTTGAGTTGAGACTGCTGCAAGTCTTTTGTTTTCTTGATGATGACCAAGCCTGGGGG
TGCATTTTGTACCTACATACATTAGACAAATCTAATGTCGGTGTATATACTAGATATTTATTTATGGATATAGGGGAAGATTGGTTTAGT
T

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan