ESTScan Details for Unigene SGN-U585621

Score 
1361
Direction 
Forward
Predicted Peptide Sequence 
MGSTFNTQILVDKLEMLKVHSKALKLYHIGVFFXMTKAKQVVETWAQQFHCSPREQRLSFLYLANDILQNSRRKGAEFVAEFWKVLPDAL
RDVIENGNEFGRNAALRLISIWDERKVFGSRGQILKEEFAGKHVGNGKHSGGKVRNSAGDALDKIVSSYQILYGGQIDEDAILSRAKNAI
SCVAKIDKKIGSDLNPGHLNGSGIVDELKGQHTILKDCVEQLTTVESSRVNLISHLREVLQEQEYKLDQVRNHLQAAQSHADQVGSICGQ
LLNFDGNGQILAEQNIKEANTSQAPHSFISGNREQSAPVMYTRQVSYEKSGNLEEDMKSAAAAVAAKLTASTSSAQMLSYVLSSLASEGV
IGNSTKESLHDNQPEKRMKLENDGSCYAPSQNPQEAVTFFSQPNSVQHNLASTGRESTPTEPPPLPSSPPPLAPLPPMQPYPAGQIIQTS
GQLPSSTFVYATSQQVQPASTLGGFVPPVNGISPFTYPATIGYQGYSSDSSLYSHQSSSLPMAPVSRP*
Predicted Coding Sequence 
ATGGGGAGCACATTCAATACGCAAATTTTGGTGGATAAGCTGGAAATGCTTAAAGTTCACAGCAAAGCATTGAAACTTTATCACATTGGT
GTATTTTTCAXCATGACCAAAGCAAAACAAGTTGTGGAAACCTGGGCCCAGCAATTCCATTGCTCACCACGTGAACAGAGATTGTCATTT
CTTTACCTTGCAAATGACATCCTTCAGAATAGTCGGAGAAAGGGTGCAGAATTTGTTGCTGAATTTTGGAAGGTTCTTCCAGATGCTCTT
CGTGATGTTATTGAAAATGGAAATGAGTTTGGAAGAAACGCTGCTTTGCGGCTGATCAGTATCTGGGACGAGAGAAAAGTCTTTGGTTCT
CGAGGGCAGATCCTGAAGGAAGAGTTTGCTGGAAAGCATGTTGGGAATGGAAAGCATAGTGGAGGCAAAGTGAGAAACTCAGCTGGAGAT
GCCCTTGACAAAATAGTTTCAAGCTATCAGATATTGTATGGTGGTCAAATTGATGAAGATGCGATATTGAGCAGAGCTAAAAATGCTATT
AGCTGTGTTGCAAAAATAGATAAGAAGATTGGGAGTGATTTAAATCCAGGCCATCTTAATGGATCTGGTATAGTGGATGAGCTCAAGGGG
CAGCACACAATATTGAAGGACTGTGTTGAGCAGCTAACAACTGTTGAGTCATCCAGGGTAAACCTCATCTCTCATCTCAGAGAGGTCCTC
CAGGAGCAGGAATATAAGTTGGATCAAGTACGCAATCATCTTCAGGCTGCTCAGTCCCACGCAGATCAGGTTGGGAGTATTTGCGGACAG
TTGCTGAATTTTGATGGCAATGGGCAAATCTTGGCTGAGCAGAATATAAAGGAAGCTAACACCTCCCAAGCTCCACATTCGTTCATATCT
GGAAATCGCGAACAATCTGCTCCAGTGATGTACACTCGACAGGTATCTTATGAAAAATCTGGCAACCTTGAGGAAGATATGAAGTCTGCG
GCTGCTGCAGTGGCAGCAAAGCTGACTGCATCAACATCTTCAGCCCAGATGCTGTCTTATGTCCTCTCATCCTTGGCATCGGAGGGTGTC
ATAGGCAACTCAACTAAAGAATCTTTGCATGATAATCAACCGGAGAAAAGGATGAAGCTTGAAAATGATGGCTCTTGTTATGCTCCCTCT
CAGAATCCTCAAGAAGCGGTTACATTTTTCTCTCAGCCAAACTCAGTACAACACAATCTTGCAAGCACTGGGCGGGAATCAACTCCAACT
GAACCACCTCCTCTACCATCATCGCCTCCACCATTGGCACCGTTGCCTCCTATGCAGCCATATCCAGCAGGTCAGATCATTCAGACATCT
GGGCAGTTGCCTAGTTCAACGTTTGTTTACGCAACAAGCCAGCAAGTGCAACCAGCTTCAACATTGGGTGGTTTTGTCCCTCCAGTGAAT
GGGATTTCTCCTTTCACATATCCGGCGACAATTGGTTATCAAGGTTATTCAAGTGATAGTAGTTTATATAGCCACCAGTCTTCATCCCTG
CCGATGGCACCAGTTAGCCGTCCGTAG
Edits in Original Sequence 
TTCAATTACGAATTGATTTTGTTTCTTACAATTCCCTTCGCCGCTACTCACTTCTGCTGCATTCTGAGTGTTCTTTTCTCATAAAGGTCT
GCTTGCGGCTTACTAGTTGATGAATATTGCTTCCGAAACA
(5')ATGGGGAGCACATTCAATACGCAAATTTTGGTGGATAAGCTGGAAA
TGCTTAAtAGTTCACAGCAAAGCATTGAAACTTTATCACATTGGTGTATTTTTCAXCATGACCAAAGCAAAACAAGTTGTGGAAACCTGG
GCCCAGCAATTCCATTGCTCACCACGTGAACAGAGATTGTCATTTCTTTACCTTGCAAATGACATCCTTCAGAATAGTCGGAGAAAGGGT
GCAGAATTTGTTGCTGAATTTTGGAAGGTTCTTCCAGATGCTCTTCGTGATGTTATTGAAAATGGAAATGAGTTTGGAAGAAACGCTGCT
TTGCGGCTGATCAGTATCTGGGACGAGAGAAAAGTCTTTGGTTCTCGAGGGCAGATCCTGAAGGAAGAGTTTGCTGGAAAGCATGTTGGG
AATGGAAAGCATAGTGGAGGCAAAGTGAGAAACTCAGCTGGAGATGCCCTTGACAAAATAGTTTCAAGCTATCAGATATTGTATGGTGGT
CAAATTGATGAAGATGCGATATTGAGCAGAGCTAAAAATGCTATTAGCTGTGTTGCAAAAATAGATAAGAAGATTGGGAGTGATTTAAAT
CCAGGCCATCTTAATGGATCTGGTATAGTGGATGAGCTCAAGGGGCAGCACACAATATTGAAGGACTGTGTTGAGCAGCTAACAACTGTT
GAGTCATCCAGGGTAAACCTCATCTCTCATCTCAGAGAGGTCCTCCAGGAGCAGGAATATAAGTTGGATCAAGTACGCAATCATCTTCAG
GCTGCTCAGTCCCACGCAGATCAGGTTGGGAGTATTTGCGGACAGTTGCTGAATTTTGATGGCAATGGGCAAATCTTGGCTGAGCAGAAT
ATAAAGGAAGCTAACACCTCCCAAGCTCCACATTCGTTCATATCTGGAAATCGCGAACAATCTGCTCCAGTGATGTACACTCGACAGGTA
TCTTATGAAAAATCTGGCAACCTTGAGGAAGATATGAAGTCTGCGGCTGCTGCAGTGGCAGCAAAGCTGACTGCATCAACATCTTCAGCC
CAGATGCTGTCTTATGTCCTCTCATCCTTGGCATCGGAGGGTGTCATAGGCAACTCAACTAAAGAATCTTTGCATGATAATCAACCGGAG
AAAAGGATGAAGCTTGAAAATGATGGCTCTTGTTATGCTCCCTCTCAGAATCCTCAAGAAGCGGTTACATTTTTCTCTCAGCCAAACTCA
GTACAACACAATCTTGCAAGCACTGGGCGGGAATCAACTCCAACTGAACCACCTCCTCTACCATCATCGCCTCCACCATTGGCACCGTTG
CCTCCTATGCAGCCATATCCAGCAGGTCAGATCATTCAGACATCTGGGCAGTTGCCTAGTTCAACGTTTGTTTACGCAACAAGCCAGCAA
GTGCAACCAGCTTCAACATTGGGTGGTTTTGTCCCTCCAGTGAATGGGATTTCTCCTTTCACATATCCGGCGACAATTGGTTATCAAGGT
TATTCAAGTGATAGTAGTTTATATAGCCACCAGTCTTCATCCCTGCCGATGGCACCAGTTAGCCGTCCGTAG(3')GTTGTTATTTTAGA
GCTATACATAGCTTGTGTTGGTTAACTGGTCTGATGTACAAGAAAGATTAGGCTGTAACTATGTAACTTTATATTGTGTTTTTGTTTCTA
GATTGGAGGTTGTTGTTGGTGTTATTGCACTAGAAAGAAGTCGGTGTGGAAATATTAGTAAAATGTTCAATTGCTAATTAATTCTCCAGT
TTATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan