ESTScan Details for Unigene SGN-U585632

Score 
931
Direction 
Forward
Predicted Peptide Sequence 
XPRKTLIPLAEKKEGVAXKMVFTISSNPVQFTHTTSLNARPNCYLKASVPVSNLSFSFFRHEYIRFSVKSRLNKRMVCAAASAAGSSSSS
DDSNPYEVLGVNPIEGFDMVKAAYARRRKDAERRGDEATLAQLEKAYDKIMMSQLTKRKQGVTFGSFKVSKEVRYADKQPILPWGPRFTK
SDDKDIKINLAISAVFIAWVFINRNAEWKPLQFLAFAFVYRIFEKLKAFEPPTPTFTEEGEDEGXDDEDGKKAASSLALVFGCIAIASLG
YTGLLNLIEYAGGFIPVFLYNNQELLVTGFTAIVLSIIASYYR*
Predicted Coding Sequence 
XTACCGAGGAAAACCCTAATCCCTTTAGCAGAGAAGAAAGAAGGAGTAGCTXCAAAAATGGTGTTTACAATATCATCAAACCCTGTTCAG
TTTACACATACTACTTCTTTAAATGCTCGACCCAATTGTTATCTCAAAGCTTCTGTTCCAGTTTCAAATTTATCGTTTTCTTTCTTCAGA
CATGAATACATCAGGTTTTCTGTAAAATCTCGCCTGAATAAAAGGATGGTCTGTGCTGCTGCTTCAGCTGCTGGAAGTTCTAGTTCTAGC
GATGACTCAAATCCTTATGAGGTTCTGGGTGTAAACCCTATTGAGGGATTTGACATGGTTAAGGCAGCATATGCAAGGAGAAGGAAAGAT
GCTGAGCGGAGGGGTGATGAAGCAACGCTTGCTCAGTTGGAGAAGGCTTATGACAAAATCATGATGTCACAGTTAACAAAAAGGAAGCAG
GGTGTCACTTTTGGCTCGTTTAAGGTATCTAAAGAGGTACGATATGCTGATAAGCAGCCTATTTTGCCATGGGGTCCACGGTTCACCAAA
TCTGATGACAAAGATATCAAAATCAACTTGGCAATTTCAGCTGTATTTATAGCTTGGGTTTTTATAAATCGTAATGCTGAGTGGAAGCCT
TTACAGTTTTTGGCCTTCGCCTTTGTATATAGGATATTTGAGAAATTAAAAGCATTTGAGCCTCCAACTCCCACGTTTACAGAGGAAGGC
GAAGATGAAGGACXGGATGATGAGGATGGGAAAAAGGCTGCTTCTTCTCTTGCATTAGTTTTTGGTTGCATAGCTATTGCATCCTTGGGA
TATACTGGTCTCCTCAATCTTATCGAGTATGCTGGTGGTTTCATACCTGTCTTTCTGTACAATAATCAGGAATTGCTTGTAACTGGATTC
ACAGCCATCGTGCTTTCCATCATCGCATCTTATTACAGATAG
Edits in Original Sequence 
(5')XTACCGAGGAAAACCCTAATCCCTTTAGCAGAGAAGAAAGAAGGAGTAGCTXCAAAAATGGTGTTTACAATATCATCAAACCCTGT
TCAGTTTACACATACTACTTCTTTAAATGCTCGACCCAATTGTTATCTCAAAGCTTCTGTTCCAGTTTCAAATTTATCGTTTTCTTTCTT
CAGACATGAATACATCAGGTTTTCTGTAAAATCTCGCCTGAATAAAAGGATGGTCTGTGCTGCTGCTTCAGCTGCTGGAAGTTCTAGTTC
TAGCGATGACTCAAATCCTTATGAGGTTCTGGGTGTAAACCCTATTGAGGGATTTGACATGGTTAAGGCAGCATATGCAAGGAGAAGGAA
AGATGCTGAGCGGAGGGGTGATGAAGCAACGCTTGCTCAGTTGGAGAAGGCTTATGACAAAATCATGATGTCACAGTTAACAAAAAGGAA
GCAGGGTGTCACTTTTGGCTCGTTTAAGGTATCTAAAGAGGTACGATATGCTGATAAGCAGCCTATTTTGCCATGGGGTCCACGGTTCAC
CAAATCTGATGACAAAGATATCAAAATCAACTTGGCAATTTCAGCTGTATTTATAGCTTGGGTTTTTATAAATCGTAATGCTGAGTGGAA
GCCTTTACAGTTTTTGGCCTTCGCCTTTGTATATAGGATATTTGAGAAATTAAAAGCATTTGAGCCTCCAACTCCCACGTTTACAGAGGA
AGGCGAAGATGAAGGACXGGATGATGAGGATGGGAAAAAGGCTGCTTCgTTCTCTTGCATTAGTTTTTGGTTGCATAGCTATTGCATCCT
TGGGATATACTGGTCTCCTCAATCTTATCGAGTATGCTGGTGGTTTCATACCTGTCTTTCTGTACAATAATCAGGAATTGCTTGTAACTG
GATTCACAGCCATCGTGCTTTCCATCATCGCATCTTATTACAGATAG(3')TCTACCTTCTACACTTGTTGAAGAAGAGATGCAGTTGCC
TTGTGTTAGCTGTCAAATTTTGTAATTCTATTTGTTCCAGAAATTTGCCTTGTTTTGTCTATAGGATTTGATTGAGCAGCACTTGTAAGG
ATGCACCAAGTTCTGAGGATTCTAGGATTAAACAAGACCACAATCTTTTCAAAATTGATGGATGTTAATGTGGAGATATAAATGATAATG
AGGAGGAAAGGTTAGGGCGGATCAATCCTTCATTGAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan