ESTScan Details for Unigene SGN-U585673

Score 
1097
Direction 
Forward
Predicted Peptide Sequence 
XKDLLSSFISSNSGNSTXKKGKDSYEEENYCKKIVADSDTLLGNSNWVWVFLGDGLNPSSRMDSQTAAEKAVSVIGLGYDLTSDIRLTAC
KIGPNGYGLIEIDQKSTKDXAGAWWGGGFNVSTSIKCDKGERTRFRSDALSFSQMSEQLNQELSLSGKIPSGLFNAMFGHKGCWQKDASS
TKLLAFDGWFITLYNIELVRSHLTLSEQVKQDVPSSWDPPALAEFIEKYGTHIVVGVKMGGKDVIHIKQLQNSVLQPMEVQKLLKQLADE
KFSEDINGCQIAKPVRSVEKSKGEKSIFSDPHLPFANSMRPSIMSYSKADDLLSIHIRRGGLDFGQSHSQWLPTVSQSPNAISMSFVPIA
SLLSGVRGSGFLSHAINLYLRYKPPIEELEQFLEFQLPRQWAPAYGDLPLGHRHRKQASPSLQFTLMGPKLYVNTVKVDSGNRPVTGIRL
YLEGKRSDHLAIHLQHLSALPQSIQLTDDLSYEPVDEPVERGYLEPVKWSIFSHVCTAPVEYRGTRIDDSASIVTKAWFEVKVIGMKKVL
FLRLGFSMVASAKIRRSEWEGPATXMSKIRFDLNADHYPIQYKAKPTPEANKGGLEFRGLPGGPPSPARAPKMSHFVDTTEMVRGPEESP
GYWVVTGAKLCVEDSRIRMKVKYSLLTILTEESLLI*
Predicted Coding Sequence 
XXGAAAGACCTGCTTTCTTCTTTCATCAGCTCTAATTCTGGAAATAGTACTXCAAAAAAGGGCAAAGACTCCTATGAAGAAGAGAATTAC
TGTAAAAAAATAGTTGCAGATTCTGACACCCTTTTGGGAAATTCGAATTGGGTTTGGGTTTTCTTGGGAGATGGCTTAAATCCTAGTAGT
AGAATGGACTCACAAACGGCTGCTGAAAAAGCCGTCTCTGTGATTGGGTTAGGTTATGATTTGACAAGTGATATCCGGTTGACGGCCTGT
AAAATCGGACCGAATGGGTATGGTTTGATAGAGATTGATCAGAAGTCGACCAAGGACXCTGCTGGTGCCTGGTGGGGTGGTGGTTTCAAT
GTTTCCACCTCTATCAAGTGCGATAAAGGGGAACGAACTAGGTTTCGCTCTGATGCTCTTTCTTTTAGTCAGATGTCAGAGCAATTAAAT
CAGGAGCTGTCCCTGTCTGGTAAGATACCTTCTGGGTTGTTTAATGCGATGTTTGGTCACAAGGGATGCTGGCAAAAAGATGCATCTTCG
ACAAAGCTTCTCGCTTTTGATGGTTGGTTCATTACCTTGTACAATATTGAGTTGGTGAGATCCCATCTAACACTGTCTGAGCAAGTAAAA
CAAGACGTGCCTTCTTCTTGGGATCCTCCTGCACTTGCAGAGTTTATTGAAAAATATGGCACCCATATTGTTGTCGGGGTAAAGATGGGA
GGTAAAGATGTAATTCACATAAAGCAACTGCAAAATTCCGTTCTTCAGCCAATGGAGGTGCAGAAATTACTCAAGCAATTAGCTGATGAA
AAATTTTCAGAAGACATAAATGGATGCCAGATAGCAAAACCTGTTAGATCTGTTGAAAAATCAAAGGGCGAAAAATCAATATTCTCAGAT
CCGCATCTACCATTTGCAAACTCAATGAGACCATCTATTATGTCTTACTCCAAAGCTGATGATCTACTAAGTATTCATATCCGACGAGGA
GGTCTTGATTTTGGTCAAAGTCATAGCCAGTGGCTTCCTACTGTATCACAGTCCCCCAATGCTATATCAATGTCGTTTGTGCCAATCGCT
TCACTTTTGAGTGGTGTAAGGGGCAGTGGATTTTTAAGCCATGCAATTAATCTTTACCTGCGATATAAACCACCAATCGAGGAACTTGAA
CAATTTTTAGAATTTCAGTTACCTCGGCAGTGGGCTCCAGCATATGGTGATCTTCCTCTTGGTCATCGCCACAGAAAACAGGCCTCTCCA
TCCTTGCAGTTCACTTTGATGGGTCCAAAGCTATACGTTAACACTGTAAAGGTTGACTCTGGAAACAGGCCAGTAACTGGAATTCGGTTA
TACTTGGAAGGTAAAAGGAGTGATCACCTGGCTATCCATCTTCAACATCTATCAGCACTTCCTCAAAGTATCCAACTAACAGATGATCTT
AGCTATGAGCCTGTCGATGAACCAGTTGAACGAGGGTATCTTGAACCTGTCAAATGGAGCATATTTTCACATGTTTGCACCGCCCCAGTA
GAATACCGTGGAACACGGATCGATGACTCTGCTTCTATTGTGACCAAGGCCTGGTTTGAGGTGAAGGTTATTGGAATGAAGAAGGTCCTC
TTCCTGAGGCTGGGATTCTCGATGGTCGCCTCAGCGAAGATCCGTCGGTCAGAGTGGGAAGGACCAGCAACCAXCATGTCGAAAATCAGG
TTTGATCTCAATGCTGATCACTACCCCATTCAGTACAAAGCTAAACCAACCCCAGAAGCCAACAAAGGTGGACTTGAATTCCGCGGTTTA
CCTGGTGGTCCACCTTCACCAGCAAGAGCGCCAAAGATGTCGCACTTTGTTGATACAACAGAAATGGTAAGAGGTCCCGAGGAGTCCCCT
GGTTACTGGGTGGTTACTGGTGCAAAGCTGTGTGTAGAAGATAGTAGGATAAGAATGAAAGTGAAGTACTCCCTCTTAACCATACTTACA
GAGGAGTCATTGTTGATATAA
Edits in Original Sequence 
(5')XXGAAAGACCTGCTTTCTTCTTTCATCAGCTCTAATTCTGGAAATAGTACTXCAAAAAAGGGCAAAGACTCCTATGAAGAAGAGAA
TTACTGTAAAAAAATAGTTGCAGATTCTGACACCCTTTTGGGAAATTCGAATTGGGTTTGGGTTTTCTTGGGAGATGGCgTTAAATCCTA
GTAGTAGAATGGACTCACAAACGGCTGCTGAAAAAGCCGTCTCTGTGATTGGGTTAGGTTATGATTTGACAAGTGATATCCGGTTGACGG
CCTGTAAAATCGGACCGAATGGGTATGGTTTGATAGAGATTGATCAGAAGTCGACCAAGGACXCTGCTGGTGCCTGGTGGGGTGGTGGTT
TCtAATGTTTCCACCTCTATCAAGTGCGATAAAGGGGAACGAACTAGGTTTCGCTCTGATGCTCTTTCTTTTAGTCAGATGTCAGAGCAA
TTAAATCAGGAGCTGTCCCTGTCTGGTAAGATACCTTCTGGGTTGTTTAATGCGATGTTTGGTCACAAGGGATGCTGGCAAAAAGATGCA
TCTTCGACAAAGCTTCTCGCTTTTGATGGTTGGTTCATTACCTTGTACAATATTGAGTTGGTGAGATCCCATCTAACACTGTCTGAGCAA
GTAAAACAAGACGTGCCTTCTTCTTGGGATCCTCCTGCACTTGCAGAGTTTATTGAAAAATATGGCACCCATATTGTTGTCGGGGTAAAG
ATGGGAGGTAAAGATGTAATTCACATAAAGCAACTGCAAAATTCCGTTCTTCAGCCAATGGAGGTGCAGAAATTACTCAAGCAATTAGCT
GATGAAAAATTTTCAGAAGACATAAATGGATGCCAGATAGCAAAACCTGTTAGATCTGTTGAAAAATCAAAGGGCGAAAAATCAATATTC
TCAGATCCGCATCTACCATTTGCAAACTCAATGAGACCATCTATTATGTCTTACTCCAAAGCTGATGATCTACTAAGTATTCATATCCGA
CGAGGAGGTCTTGATTTTGGTCAAAGTCATAGCCAGTGGCTTCCTACTGTATCACAGTCCCCCAATGCTATATCAATGTCGTTTGTGCCA
ATCGCTTCACTTTTGAGTGGTGTAAGGGGCAGTGGATTTTTAAGCCATGCAATTAATCTTTACCTGCGATATAAACCACCAATCGAGGAA
CTTGAACAATTTTTAGAATTTCAGTTACCTCGGCAGTGGGCTCCAGCATATGGTGATCTTCCTCTTGGTCATCGCCACAGAAAACAGGCC
TCTCCATCCTTGCAGTTCACTTTGATGGGTCCAAAGCTATACGTTAACACTGTAAAGGTTGACTCTGGAAACAGGCCAGTAACTGGAATT
CGGTTATACTTGGAAGGTAAAAGGAGTGATCACCTGGCTATCCATCTTCAACATCTATCAGCACTTCCTCAAAGTATCCAACTAACAGAT
GATCTTAGCTATGAGCCTGTCGATGAACCAGTTGAACGAGGGTATCTTGAACCTGTCAAATGGAGCATATTTTCACATGTTTGCACCGCC
CCAGTAGAATACCGTGGAACACGGATCGATGACTCTGCTTCTATTGTGACCAAGGCCTGGTTTGAGGTGAAGGTTATTGGAATGAAGAAG
GTCCTCTTCCTGAGGCTGGGATTCTCGATGGTCGCCTCAGCGAAGATCCGTCGGTCAGAGTGGGAAGGACCAGCAACCAXCATGTCGAAA
ATCAGGTTTGATCTCAATGCTGATCACTACCCCATTCAGTACAAAGCTAAACCAACCCCAGAAGCCAACAAAGGTGGACTTGAATTCCGC
GGTTTAtCCTGGTGGTCCACCTTCACCAGCAAGAGCGCCAAAGATGTCGCACTTTGTTGATACAACAGAAATGGTAAGAGGTCCCGAGGA
GTCCCCTGGTTACTGGGTGGTTACTGGTGCAAAGCTGTGTGTAGAAGATAGTAGGATAAGAATGAAAGTGAAGTACTCCCTCTTAACCAT
ACTTACAGAGGAGTCATTGTTGATATAA(3')ACGATTGAAAGATTTCATTTCAAGCTTTATCCATCTTTCTCTATAGGACATTGTGTAT
ATTTCATCTGATATTTGCGCAGATATGCAGAAAGTGTTATAGCAAGGTCAAATTGACCCAGTTAACAGTTGAGTGTGTAAAGAAATTATA
AAACTTTTGTTGAAAGAAAACGAAGAGTTTCTGAATGTACATTTAACGTTCCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan