ESTScan Details for Unigene SGN-U585710

Score 
869
Direction 
Forward
Predicted Peptide Sequence 
XRAQKGKRIVVLLEFIIPFTWELVFCYVLRFFTLKNPNLLKFLSNLSYRKTLILQKQYHMDAKDILGLPKNGPLMSQEKKSRPQKESQRK
PDGISREVYALTGGIAPLMPSIDINQLKKRALSESEKITWQWLPFTSSARKDNLQLYHWVRVVNGVPPTGDYSFAKYNKSVDVIEYTDEE
YEKFLSNPSWTKEETDQLFDLCKRFDLRFVIIADRFPSNRTIEELKDRYYSVSRAITIARAPSPADVAGHPLVKPYNASQEVERKRALSM
VLSQTKHQERRDAEVLAAAKRISESRKAAKAAEETELPDVSDAAPEGAEKAGIDVISTSPNAQLPSGIAAPPVSETASTLASLRMLXRVF
ENIWTGANGPSWSSSAGLRTIKRVEQTLQDLGVNLKPKVPTKLVCAEHLELRKEILTLLNLQKQVQYKESEGSSYREGSYSETPGTPPKR
AQRATDQDRTFIPDSTSFGGERAGKKDQKRKGPGRLSEVPSSPAQSKRPRKLKLQMDELEGLKLQGADKKLLQINFFILCSAAFLNLLHH
ENMIQPFKTSNVAVSFEWHKNVDATLMPFYGDQVLLCIRVQSPQSVYTSDLIVVISMXNLTLLTVSLWHVTKLLSLLAVSVLTHQSSSAL
VAFGLLTRKD*YELTLALHXKLKQIV**
Predicted Coding Sequence 
XXGCGCGCTCAAAAAGGGAAACGGATCGTTGTTCTTCTTGAATTCATAATCCCATTCACCTGGGAACTAGTTTTCTGCTATGTTCTTCGA
TTCTTCACACTCAAAAACCCTAATTTGTTGAAGTTTTTGTCTAATTTATCATACAGAAAAACCCTAATTTTGCAGAAACAATACCATATG
GATGCGAAGGACATCTTAGGATTGCCTAAAAATGGACCTTTAATGTCCCAAGAGAAGAAATCGAGGCCTCAGAAAGAGTCTCAAAGGAAA
CCTGATGGCATTTCGCGAGAAGTTTATGCACTTACAGGTGGTATTGCACCTCTTATGCCTTCTATTGATATAAATCAGCTGAAAAAGCGA
GCTCTTTCGGAGTCCGAAAAGATTACGTGGCAATGGCTTCCATTCACAAGTTCTGCTAGAAAAGATAACTTACAGCTTTATCATTGGGTC
AGAGTTGTTAATGGTGTTCCGCCTACAGGTGACTATTCGTTTGCAAAGTATAATAAGTCGGTGGATGTGATCGAGTACACAGATGAGGAG
TATGAGAAGTTCTTGTCCAATCCTTCATGGACGAAGGAAGAGACGGATCAATTATTTGACCTGTGCAAGAGGTTTGATCTCCGTTTTGTT
ATCATAGCTGATAGGTTCCCTTCAAATCGTACAATTGAGGAATTGAAGGACCGTTATTACAGTGTGTCTCGTGCTATTACAATTGCTAGG
GCTCCATCTCCTGCCGATGTTGCTGGACATCCCCTTGTTAAGCCTTACAATGCTTCACAAGAGGTTGAGCGAAAACGTGCACTGTCGATG
GTGCTCTCACAAACAAAGCATCAGGAGCGTAGGGATGCAGAGGTTCTTGCTGCAGCAAAAAGAATATCCGAATCACGAAAAGCTGCTAAG
GCCGCTGAAGAAACAGAACTTCCCGATGTGTCAGATGCTGCTCCTGAAGGTGCTGAAAAGGCTGGTATTGATGTAATATCAACCTCTCCA
AATGCTCAATTACCCTCTGGCATTGCTGCACCTCCAGTGTCAGAGACTGCTTCCACTTTGGCTTCTCTTCGCATGCTGCXGCGTGTATTT
GAGAACATATGGACTGGAGCAAATGGTCCAAGCTGGAGCTCTTCAGCTGGACTCCGGACAATCAAACGGGTTGAACAAACTTTACAAGAC
CTTGGGGTTAATTTGAAGCCAAAGGTCCCAACAAAACTTGTCTGTGCGGAGCATCTTGAACTGAGGAAAGAGATACTAACCCTGTTAAAT
CTTCAAAAGCAGGTACAATACAAGGAGTCAGAAGGCTCATCTTATCGGGAAGGTTCATATTCTGAAACACCTGGTACACCTCCTAAGCGT
GCGCAACGTGCTACGGACCAAGATAGAACATTCATTCCCGATTCTACAAGTTTTGGAGGGGAAAGAGCTGGTAAAAAGGACCAGAAACGC
AAGGGGCCTGGACGATTATCAGAAGTACCATCTTCACCAGCACAGTCAAAACGGCCTCGCAAGTTAAAACTTCAGATGGATGAATTGGAA
GGACTAAAGCTACAAGGAGCTGATAAGAAGCTGCTTCAAATCAACTTCTTTATCCTGTGTTCTGCXGCCTTTTTGAATTTGCTCCACCAT
GAAAACATGATCCAGCCTTTCAAAACTTCAAATGTGGCTGTCTCATTTGAGTGGCACAAGAATGTTGATGCCACTCTAATGCCTTTCTAT
GGAGATCAAGTCCTCCTTTGCATCAGAGTACAGTCCCCGCAGTCTGTATATACATCTGATCTTATAGTTGTGATTAGCATGTTXAACCTC
ACCTTGCTTACGGTGTCTCTTTGGCATGTCACTAAATTATTGAGCCTATTGGCTGTTTCTGTATTAACACATCAAAGTAGTTCTGCTTTA
GTCGCATTTGGATTGCTTACCAGGAAGGACTGATATGAGTTAACACTGGCACTGCATAXGAAGCTGAAACAGATAGTGTAGTGA
Edits in Original Sequence 
(5')XXGCGCGCTCAAAAAGGGAAACGGATCGTTGTTCTTCTTGAATTCATAATCCCATTCACCTGGGAACTAGTTTTCTGCTATGTTCT
TCGATTCTTCACACTCAAAAACCCTAATTTGTTGAAGTTTTTGTaCTAATTTATCATACAGAAAAACCCTAATTTTGCAGAAACAATACC
ATATGGATGCGAAGGACATCTTAGGATTGCCTAAAAATGGACCTTTAATGTCCCAAGAGAAGAAATCGAGGCCTCAGAAAGAGTCTCAAA
GGAAACCTGATGGCATTTCGCGAGAAGTTTATGCACTTACAGGTGGTATTGCACCTCTTATGCCTTCTATTGATATAAATCAGCTGAAAA
AGCGAGCTCTTTCGGAGTCCGAAAAGATTACGTGGCAATGGCTTCCATTCACAAGTTCTGCTAGAAAAGATAACTTACAGCTTTATCATT
GGGTCAGAGTTGTTAATGGTGTTCCGCCTACAGGTGACTATTCGTTTGCAAAGTATAATAAGTCGGTGGATGTGATCGAGTACACAGATG
AGGAGTATGAGAAGTTCTTGTCCAATCCTTCATGGACGAAGGAAGAGACGGATCAATTATTTGACCTGTGCAAGAGGTTTGATCTCCGTT
TTGTTATCATAGCTGATAGGTTCCCTTCAAATCGTACAATTGAGGAATTGAAGGACCGTTATTACAGTGTGTCTCGTGCTATTACAATTG
CTAGGGCTCCATCTCCTGCCGATGTTGCTGGACATCCCCTTGTTAAGCCTTACAATGCTTCACAAGAGGTTGAGCGAAAACGTGCACTGT
CGATGGTGCTCTCACAAACAAAGCATCAGGAGCGTAGGGATGCAGAGGTTCTTGCTGCAGCAAAAAGAATATCCGAATCACGAAAAGCTG
CTAAGGCCGCTGAAGAAACAGAACTTCCCGATGTGTCAGATGCTGCTCCTGAAGGTGCTGAAAAGGCTGGTATTGATGTAATATCAACCT
CTCCAAATGCTCAATTACCCTCTGGCATTGCTGCACCTCCAGTGTCAGAGACTGCTTCCACTTTGGCTTCTCTTCGCATGCTGCXGCGTG
TATTTGAGAACATATGGACTGGAGCAAATGGTCCAAGCTGcGAGCTCTTCAGCTGGACTCCGGACAATCAAACGGGTTGAACAAACTTTA
CAAGACCTTGGGGTTAATTTGAAGCCAAAGGTCCCAACAAAACTTGTCTGTGCGGAGCATCTTGAACTGAGGAAAGAGATACTAACCCTG
TTAAATCTTCAAAAGCAGGTACAATACAAGGAGTCAGAAGGCTCATCTTATCGGGAAGGTTCATATTCTGAAACACCTGGTACACCTCCT
AAGCGTGCGCAACGTGCTACGGACCAAGATAGAACATTCATTCCCGATTCTACAAGTTTTGGAGGGGAAAGAGCTGGTAAAAAGGACCAG
AAACGCAAGGGGCCTGGACGATTATCAGAAGTACCATCTTCACCAGCACAGTCAAAACGGCCTCGCAAGTTaAAAACTTCAGATGGATGA
ATTGGAAGGACTAAAGCTACAAGGAGCTGtATAAGAAGCTGCTTCAAATCAACTTCTTTATCCTGTGTTCTGCXGCCTTTTTGAATTTGC
TCCACCATGAAAACATGATCCAGCCTTTCAAAACTTCAAATGTGGCTGTCTCATTTGAGTGGCACAAGAATGTTaGATGCCACTCTAATG
CCTTTCTATGGAGATCAAGTCCTCCTTTGCATCAGAGTACAGTCCCCGCAGTCTGTATATACATCTGtATCTTATAGTTGTGATTAGCAT
GTTXAACCTCACCTTGCTTACGGTGTCTCTTTGGCATGTCACTAAATTATTGAGCCgTATTGGCTGTTTCTGTATTAACACATCAAAGTA
GTTCTGCTTTAGTCGCATTTGGATTGCTTACCAGGAAGGACTGATATGAGTTAACACTGGCACTGCATAXGAAGCTGAAACAGATAGTGT
AGTGA(3')TTGCGAACCATAATATATCCTTTCTATATGTTAAGAATTTTATGAAGTTAAATTTGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan