ESTScan Details for Unigene SGN-U585728

Score 
496
Direction 
Forward
Predicted Peptide Sequence 
ASVVFRHQMSSVWEIEFMGSMGLRALVGVQTTRHISVHSTATMGLAMSLRDGSVNLSNTWTRQLSDTAHGNIHLSLGPESSIAVGWQRKE
QKRSASGEIKLGTGSFGATANYTHRFSTKSHGRIGARIGSTALELELGGGRKVSEFSTIRMLYSIGIQGIFWKFELHRGGQKLIVPVLLS
RHLNPIFATGAXSGTDLTVFCTEEICCETFLSSARKAEASENMDKTLGQVREARTAAKKAQQLLQNVANRKRSRQLEAGGLGCYKSTVWQ
SKALKNRNQIEEVKDEVASQIIDVTLPLNFLVSDSGQLKLHEGVKKSRIMGFCDPCPGKPKQX
Predicted Coding Sequence 
GCATCTGTTGTTTTTAGGCATCAAATGTCATCAGTTTGGGAGATAGAGTTTATGGGGTCTATGGGTTTGAGAGCATTAGTAGGAGTACAA
ACAACTCGTCATATATCTGTTCACTCTACGGCAACAATGGGTCTTGCTATGTCTTTAAGAGATGGTTCTGTTAATCTCTCCAACACTTGG
ACTCGCCAGCTATCTGATACTGCTCATGGAAATATACATCTTTCATTAGGTCCTGAGTCATCTATAGCTGTTGGATGGCAGAGGAAGGAG
CAGAAAAGGTCTGCTTCTGGAGAGATCAAGCTAGGGACCGGGTCATTTGGTGCAACGGCTAATTACACCCACCGCTTTTCCACGAAATCC
CACGGGCGTATCGGAGCCAGAATCGGAAGTACTGCACTTGAACTAGAATTGGGAGGTGGAAGAAAAGTATCTGAATTCAGTACCATTCGG
ATGCTGTACTCTATAGGAATTCAGGGGATCTTTTGGAAGTTTGAGTTACATCGTGGGGGGCAAAAGTTGATTGTTCCTGTATTGCTTTCT
AGGCATTTGAACCCTATTTTTGCCACCGGAGCAXTTTCTGGTACCGACCTCACTGTATTTTGTACTGAAGAGATTTGTTGTGAAACCTTT
TTATCTTCAGCGCGAAAAGCAGAAGCATCAGAAAATATGGATAAAACTCTTGGCCAGGTTCGAGAAGCAAGGACGGCTGCTAAGAAAGCT
CAACAACTATTGCAAAATGTGGCCAATAGGAAAAGAAGTAGACAGCTTGAAGCAGGTGGACTGGGTTGTTACAAAAGCACTGTATGGCAG
TCTAAAGCTCTGAAGAACAGAAATCAAATAGAGGAAGTGAAAGATGAAGTGGCTTCTCAAATCATTGATGTCACTCTACCTTTAAATTTT
CTTGTGAGCGACTCCGGGCAACTAAAGCTGCACGAGGGTGTAAAAAAATCAAGAATTATGGGATTTTGTGATCCCTGTCCTGGAAAACCC
AAGCAATTX
Edits in Original Sequence 
(5')GCATCTGTTGTTTTTAGGCATCAAATGTCATCAGTTTcGGGAGATAGAGTTTATGGGGTCTATGGGTTTGAGAGCATTAGTAGGAG
TACAAACAACTCGTCATATATCTGTTCACTCTACGGCAACAATGGGTCTTGCTATGTCTTTAAGAGATGGTTCTGTTAATCTCTCCAACA
CTTGGACTCGCCAGCTATCTGATACTGCTCATGGAAATATACATCTTTCATTAGGTCCTGAGTCATCTATAGCTGTTGGATGGCAGAGGA
AGGAGCAGAAAAGGTCTGCTTCTGGAGAGATCAAGCTAGGGACCGGGTCATTTGGTGCAACGGCTAATTACACCCACCGCTTTTCCACGA
AATCCCACGGGCGTATCGGAGCCAGAATCGGAAGTACTGCACTTGAACTAGAATTGGGAGGTGGAAGAAAAGTATCTGAATTCAGTACCA
TTCGGATGCTGTACTCTATAGGAATTCAGGGGATCTTTTGGAAGTTTGAGTTACATCGTGGGGGGCAAAAGTTGATTGTTCCTGTATTGC
TTTCTAGGCATTTGAACCCTATTTTTGCCACCGGAGCAXTTTCTGGTACCGACCTCACTGTATTTTGTACTGAAGAGATTTGTTGTGAAA
CCTTTTTATCTTCAGCGCGAAAAGCAGAAgGCATCAGAAAATATGGATAAAACTCTTGGCCAGGTTCGAGAAGCAAGGACGGCTGCTAAG
AAAGCTCAACAACTATTGCAAAATGTGGCCAATAGGAAAAGAAGTAGACAGCTTGAAGCAGGTGGACTGGGTTGTTACAAAAGCACTGTA
TGGCAGTCaTAAAGCTCTGAAGAACAGAAATCAAATAGAGGAAGTGAAAGATGAAGTGGCTTCTCAAATCATTGATGTCACTCTACCTTT
AAATTTTCTTGTGAGCGACTCCGGGCAACTAAAGCTGCACGAGGGTGTAAAAAAATCAAGAATTATGGGATTTTGTGATCCCTGTCCTGG
AAAACCCAAGCAATTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan