ESTScan Details for Unigene SGN-U585890

Score 
-16
Direction 
Reverse
Predicted Peptide Sequence 
MASQPSKVDKXEKKVNKYMFSTLFTDLQNSIKLIHVMKVASDTDVDLEVGLFITQIXRIQEYGSKSGATIWLIRIYCVTIKSYPVVVTAY
IFINVXVFVFTEPTXILETASLPAKAGVRFAYTQPPTQTPHAELX
Predicted Coding Sequence 
ATGGCGTCTCAGCCCAGCAAGGTTGATAAGXTAGAGAAGAAAGTCAACAAATACATGTTTTCTACTTTATTCACAGACTTACAAAATTCT
ATTAAGCTCATTCATGTTATGAAAGTGGCATCTGATACAGATGTTGATCTAGAGGTTGGACTCTTCATTACACAAATTXCTAGGATTCAG
GAGTACGGTTCAAAGTCTGGTGCTACGATATGGCTAATAAGAATATATTGTGTCACAATTAAGAGTTATCCTGTTGTTGTTACTGCTTAT
ATCTTCATAAATGTTGXTGTTTTTGTTTTCACTGAGCCGACGGXTATATTGGAAACAGCCTCTCTACCTGCCAAGGCAGGGGTAAGGTTT
GCCTACACTCAACCCCCTACCCAGACCCCGCATGCGGAACTGCAX
Edits in Original Sequence 
TGCTCATTCCAGATTGGATTCAGTTCGTTGTTAATTGTTTTGCTCTTCTTCATTCTATCTCGTACAGGGCGTACATATAACTCAGCAAAA
GGATCAGATTTACCAATGATGTCCTTGTTTGTTAACTCTTTTGCTTGAACAAGTTTCACCTCCAATACTCCAGTAGGTTTCAGTTCAAGG
TCACTAACAATAAAGTAGATTGTCAAATAGAAA
(5')ATGGCGTCTCAGCCCAGCAAGGTTaGATAAGXTAGAGAAGAAAGTCAACAAAT
ACATGTTTTCTACTTTATTCACAGACTTACAAAATTCTATTAAGCTCATTCATGTTATGAAAGTgGGCATCTGATACAGATGTTGATCTA
GAGGTTGGACTCTTCATTACACAAATTXCTAGGATTCAGGAGTACGGTTCAAAGTCTGGTGCTACGATATGGCTAATAAGAATATATTGT
GTCACAATTAAGAGTTATCCTGTTGTTGTTACTGCTTATATCTTCATAAATGTTGXTGTTTTTGTTTTCACTGAGCCGACGGXTATATTG
GAAACAGCCTCTCTACCTGCCAAGGCAGGGGTAAGGTTTGCCTACACTCAACCCCCTACCCAGACCCCGCATGCGGAACTGCAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan