ESTScan Details for Unigene SGN-U586177

Score 
924
Direction 
Forward
Predicted Peptide Sequence 
XRAAVPPKDIAPSSPNISSKDMVAKNEGLIVFFPGIPGCAKSALCKEILNAPGGLEDDRPIHSLMGDLIKGRYWQKVADERRRKPYSIML
ADKNAPNEEVWKQIENMCLSTKASAIPVIPDSEGTEINPFSIDALAVFIFRVLQRVNHPGNLDKSSPNAGYVMLMFYHLYDGKSRQEFES
ELIERFGSLVRIPLLKPERSPLPDSVRSIVEEGINLYRLHTNKHGRLESTKGTFVKEWVKWEKQLRDILHGNADYLNSIQLAKKDPKVGD
FLKDKSLESCIQKAHLTLAHKRSHGVTAVANYGSFFTKXVPVDVAALLFSDKLAALEAEPGSVEGEKVNSKNPWPHVTIWTGAGATAKDA
NTLPQLLSQGKAIRIEINPPVTITGTXRILLNSTCNSSSCVDLPNVNPTWVLSEYHVMTLPSCRNNFVGSCALAXIAVLQLQDRNRFREN
VKMLRQ*
Predicted Coding Sequence 
XCCCGGGCTGCAGTACCXCCCAAAGATATTGCTCCTTCAAGCCCTAATATTTCCAGCAAAGACATGGTCGCAAAGAATGAGGGTCTCATC
GTTTTTTTTCCAGGAATACCAGGTTGTGCTAAATCTGCACTTTGTAAGGAAATACTGAATGCTCCAGGAGGGCTTGAAGATGATCGGCCA
ATTCATAGTTTAATGGGTGATCTTATCAAAGGTAGATATTGGCAAAAAGTTGCTGATGAACGTCGAAGAAAACCTTACTCGATCATGCTT
GCTGACAAGAATGCACCAAATGAGGAAGTATGGAAACAAATTGAGAACATGTGTCTAAGCACCAAAGCATCTGCTATTCCAGTTATACCT
GATTCAGAAGGAACTGAAATCAATCCATTCTCTATTGATGCACTGGCGGTTTTTATATTCCGAGTACTTCAGCGTGTTAATCATCCGGGA
AATCTTGACAAGTCATCTCCAAATGCTGGATATGTGATGTTAATGTTTTATCACCTTTATGATGGAAAGAGCCGTCAGGAGTTCGAGAGT
GAACTTATTGAACGTTTTGGATCACTTGTCAGAATTCCTCTACTGAAACCTGAAAGGTCTCCTCTTCCGGATTCTGTGAGGTCTATTGTT
GAGGAGGGAATCAATCTGTACAGGCTTCATACTAACAAACATGGAAGATTGGAGTCTACAAAAGGGACTTTTGTAAAAGAGTGGGTTAAA
TGGGAGAAGCAATTGAGGGATATTCTACATGGAAATGCGGACTATCTCAATTCAATACAGCTAGCCAAGAAAGATCCGAAGGTTGGTGAT
TTCTTGAAGGACAAAAGCCTGGAGAGCTGCATTCAGAAGGCTCATTTGACCCTAGCTCACAAGAGAAGTCATGGTGTCACTGCAGTTGCC
AATTACGGTTCCTTCTTCACCAAAAXCGTCCCAGTAGACGTGGCTGCTTTGTTGTTCTCCGATAAATTGGCTGCCCTAGAAGCTGAGCCT
GGTTCTGTCGAAGGTGAAAAGGTCAATTCTAAAAACCCATGGCCCCACGTCACAATATGGACTGGGGCAGGAGCTACAGCCAAAGATGCC
AATACACTACCACAGTTACTTTCTCAAGGGAAGGCTATCCGCATTGAGATAAATCCACCCGTCACTATAACTGGCACTXCTCGAATTCTT
TTGAACTCTACATGTAATTCCTCATCTTGTGTGGATTTACCTAATGTAAACCCTACATGGGTTCTGAGTGAATATCATGTAATGACACTC
CCGAGTTGTAGGAACAATTTTGTAGGATCGTGCGCTTTGGCTXATATAGCAGTCTTGCAGTTGCAGGATAGAAATAGATTTAGAGAAAAT
GTAAAGATGTTGAGGCAATAA
Edits in Original Sequence 
(5')XCCCGGGCTGCAGTACCXCCCAAAGATATTGCTCCTTCAAGCCCTAATATTTCCAGCAAAGACATGGTCGCAAAGAATGAGGGTCT
CATCGTTTTTTTTCCAGGAATACCAGGTTGTGCTAAATCTGCACTTTGTAAGGAAATACTGAATGCTCCAGGAGGGCTTGAAGATGATCG
GCCAATTCATAGTTTAATGGGTGATCTTATCAAAGGTAGATATTGGCAAAAAGTTGCTGATGAACGTCGAAGAAAACCTTACTCGATCAT
GCTTGCTGACAAGAATGCACCAAATGAGGAAGTATGGAAACAAATTGAGAACATGTGTCTAAGCACCAAAGCATCTGCTATTCCAGTTAT
ACCTGATTCAGAAGGAACTGAAATCAATCCATTCTCTATTGATGCACTGGCGGTTTTTATATTCCGAGTACTTCAGCGTGTTAATCATCC
GGGAAATCTTGACAAGTCATCTCCAAATGCTGGATATGTGATGTTAATGTTTTATCACCTTTATGATGGAAAGAGCCGTCAGGAGTTCGA
GAGTGAACTTATTGAACGTTTTGGATCACTTGTCAGAATTCCTCTACTGAAACCTGAAAGGTCTCCTCTTCCGGATTCTGTGAGGTCTAT
TGTTGAGGAGGGAATCAATCTGTACAGGCTTCATACTAACAAACATGGAAGATTGGAGTCTACAAAAGGGACTTTTGTAAAAGAGTGGGT
TAAATGGGAGAAGCAATTGAGGGATATTCTACATGGAAATGCGGACTATCTCAATTCAATACAGCTAGCCAAGAAAGATCCGAAGGTTGG
TGATTTCTTGAAGGACAAAAGCCTGGAGAGCTGCATTCAGAAGGCTCATTTGACCCTAGCTCACAAGAGAAGTCATGGTGTCACTGCAGT
TGCCAATTACGGTTCCTTCTTCACCAAAAXCGTCCCAGTAGACGTGGCTGCTTTGTTGTTCTCCGATAAATTGGCTGCCCTAGAAGCTGA
GCCTGGTTCTGTCGAAGGTGAAAAGGTCAATTCTAAAAACCCATGGCCCCACGTCACAATATGGACTGGGGCAGGAGCTACAGCCAAAGA
TGCCAATACACTACCACAGTTACTTTCTCAAGGGAAGGCTATCCGCATTGAGATAAATCCACCCGTCACTATAACTGGCACTXCTCGAAT
TCTTTTGAACTCTACATGTAATTCCTCATCTTGTGTGGATTTACCTAATGTAAACCCTACATGGGTTCTGAGTGAATATCATGTAATGAC
ACTCCCGAGTTGTAGGAACAATTTTGTAGGATCGTGCGCTTTGGCTXATATAGCAGTCTTGCAGTTGCAGGATAGAAATAGATTTAGAGA
AAATGTAAAGATGTTGAGGCAATAA(3')AGGTCTTAAGTCGTGGGCGTTTTGAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan