ESTScan Details for Unigene SGN-U586263

Score 
733
Direction 
Reverse
Predicted Peptide Sequence 
XALDIAEKFGMPEVVSILKLAGAVHSKDHGKPPNNTKQLNQTVSDIRHDVQSQLQQSRQTGFKVRKIAKKVKKLHISGLNNAINNATVVA
VLIATVAFAAIFTVPGQYVEKKKDGFSLGEANVADKAAFIIFFLFDSMALFISIAVVVVQTSLVVIEPRAKKLLVFWINRLMWAACLFIS
VSFISLAYVVVGSKERWLAIFATVIGSTIMITTIGSMCYCVVRHRLEESKMRSIRRAGTHSHSYAISVASDTELYGESYKRMYAXLGTNN
ELFAYSVKSQAXMDEKHKLIYTVLNQKLGERLFKHSVPNGLAYEGFMLVGTKENASTSVCNNTTVIWQFLIWCSCNLRQVLLXKLETDSN
RSSSFVYITFSSSRASYQGVPYYIATKSSNTAEQLGSKKV*
Predicted Coding Sequence 
XXAGCTCTTGATATTGCTGAAAAGTTTGGAATGCCAGAGGTTGTTTCCATTCTGAAGTTGGCGGGAGCTGTCCATTCCAAAGATCATGGG
AAGCCCCCAAATAACACTAAGCAACTCAATCAGACTGTCAGTGATATAAGACATGATGTGCAGTCCCAACTCCAACAGAGTCGTCAGACA
GGCTTCAAAGTACGGAAAATTGCTAAGAAGGTGAAGAAGCTCCACATTAGTGGTCTCAACAATGCCATTAACAATGCCACAGTTGTTGCT
GTCCTTATTGCTACTGTAGCTTTTGCTGCCATCTTTACTGTGCCTGGTCAGTATGTTGAAAAGAAAAAAGATGGTTTTTCGCTTGGTGAA
GCAAATGTAGCCGATAAAGCAGCTTTTATAATCTTCTTCTTGTTTGACAGTATGGCCTTGTTTATTTCCATTGCTGTTGTTGTTGTCCAG
ACTTCTCTGGTTGTGATTGAACCGAGAGCAAAGAAGCTACTCGTATTTTGGATAAACAGGCTCATGTGGGCAGCTTGTCTCTTCATCTCA
GTGTCTTTTATTTCGCTTGCTTATGTGGTGGTTGGATCGAAAGAAAGATGGCTTGCTATCTTTGCAACTGTGATTGGTAGCACCATAATG
ATCACTACAATTGGCTCCATGTGCTACTGTGTAGTTCGACATAGGCTAGAAGAGTCGAAGATGAGGAGTATAAGAAGGGCAGGAACTCAT
TCACATTCATATGCTATATCTGTGGCATCAGATACAGAGCTCTATGGTGAAAGCTACAAGAGGATGTATGCAGXTCTAGGAACAAACAAT
GAACTTTTTGCCTATAGTGTCAAATCTCAAGCTXTTATGGATGAAAAGCACAAGTTAATATATACAGTTCTAAACCAAAAGCTTGGTGAA
CGTCTCTTCAAGCACAGTGTTCCAAATGGTCTAGCATACGAAGGATTTATGCTAGTTGGAACTAAAGAGAATGCTTCCACTAGTGTATGC
AATAATACCACAGTAATTTGGCAATTCCTGATATGGTGTTCTTGTAACCTGAGGCAAGTTTTGCTTAXGAAGCTCGAGACTGACTCTAAC
AGATCATCCAGTTTTGTTTACATAACATTTAGTAGTTCAAGAGCAAGTTATCAGGGAGTTCCATACTATATAGCTACAAAAAGTAGCAAC
ACAGCAGAGCAGCTTGGTAGCAAGAAGGTGTAG
Edits in Original Sequence 
(5')XXAGCTCTTGATATTGCTGAAAAGTTTGGAATGCCAGAGGTTGTTTCCATTCTGAAGTTGGCGGGAGCTGTCCATTCCAAAGATCA
TGGGAAGCCCCCAAATAACACTAAGCAACTCAATCAGACTGTCAGTGATATAAGACATGATGTGCAGTCCCAACTCCAACAGAGTCGTCA
GACAGGCTTCAAAGTACGGAAAATTGCTAAGAAGGTGAAGAAGCTCCACATTAGTGGTCTCAACAATGCCATTAACAATGCCACAGTTGT
TGCTGTCCTTATTGCTACTGTAGCTTTTGCTGCCATCTTTACTGTGCCTGGTCAGTATGTTGAAAAGAAAAAAGATGGTTTTTCGCTTGG
TGAAGCAAATGTAGCCGATAAAGCAGCTTTTATAATCTTCTTCTTGTTTGACAGTATGGCCTTGTTTATTTCCATTGCTGTTGTTGTTGT
CCAGACTTCTCTGGTTGTGATTGAACCGAGAGCAAAGAAGCTACTCGTATTTTGGATAAACAGGCTCATGTGGGCAGCTTGTCTCTTCAT
CTCAGTGTCTTTTATTTCGCTTGCTTATGTGGTGGTTGGATCGAAAGAAAGATGGCTTGCTATCTTTGCAACTGTGATTGGTAGCACCAT
AATGATCACTACAATTGGCTCCATGTGCTACTGTGTAGTTCGACATAGGCTAGAAGAGTCGAAGATGAGGAGTATAAGAAGGGCAGGAAC
TCATTCACATTCATATGCTATATCTGTGGCATCAGATACAGAGCTCTATGGTGAAAGCTACAAGAGGATGTATGCAGXTCTAGGAACAAA
CAATaGAACTTTTTGCCTATAGTGTCAAATCTCAAGCTXTTATGGATGAAAAGCACAAGTTAATATATACAGTTCTAAACCAtAAAGCTT
GGTGAACGTCTCTTCAtAGCACAGTGTTCCAAATGGTCTAGCATACGAAGGATTTATGCTAGTTaGGAACTAAAGAGAATGCTTCCACTA
GTGTATGCAATAATACCACAGTAATTTGGCAATTCCTGATATGGTGTTCTTGTAACCTGAGGCAAGTTTTGCTTAXGAAGCTCGAGACTG
ACTCTAACAGATCATCCAGTTTTGTTTACATAACATTTAGTAGTTCAAGAGCAAGTTATCAGGGAGTTCCATACTATATAGCTACAAAAA
GTAGCAACACAGCAGAGCAGCTTGGTAGCAAGAAGGTGTAG(3')ATGGCTGATGTACAAAACAACTTTTAAATGAAAATGTACAAACAA
AAAACTTATTTTTTTGTGACAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan