ESTScan Details for Unigene SGN-U586356

Score 
233
Direction 
Forward
Predicted Peptide Sequence 
EDTTIKEDLTFESDKKIRTMNLSQLDCESAKINAIDENMSHLPFVDXKSQYKRAEATCRTQLQTPVKLIRPSLIVLIKEGGNGINVQFTS
VYKEQMEAALTKAKQIVSSNPVVVFSKTYCGYCTRVKKLLSQLGATFKVIELDRESDGDEVQAALLEWTKQRTVPNVFIGGEHVGGCDSV
LEKHQQGKLLPMLKDAAAIPNNPAKXLELIYAPSSQPDNKNEVREFCNLTASSPLVGVV**
Predicted Coding Sequence 
GAGGATACGACTATCAAAGAAGATTTGACTTTTGAAAGTGACAAAAAAATTAGGACGATGAATCTTAGCCAATTGGATTGTGAAAGTGCA
AAAATAAACGCAATTGATGAGAATATGAGCCATCTCCCTTTTGTTGATXTAAAAAGTCAATACAAGAGAGCAGAAGCCACCTGCAGAACC
CAGCTTCAAACACCTGTTAAGCTTATTCGGCCATCTTTGATTGTGTTAATAAAGGAAGGAGGCAATGGGATCAATGTTCAGTTCACCTCA
GTTTACAAAGAACAAATGGAGGCCGCTCTTACCAAAGCCAAGCAGATCGTTTCCTCTAATCCTGTTGTCGTATTCAGTAAAACATACTGC
GGATATTGCACAAGGGTGAAGAAACTTCTTTCCCAGCTTGGTGCTACTTTTAAAGTTATTGAACTTGACCGGGAAAGTGATGGAGATGAG
GTTCAAGCAGCATTACTAGAATGGACTAAGCAGAGGACTGTGCCTAACGTGTTTATTGGGGGAGAACATGTTGGTGGCTGCGACAGCGTA
TTAGAGAAGCATCAACAGGGAAAGCTACTTCCCATGCTGAAGGACGCCGCTGCTATTCCCAACAATCCTGCCAAAGXTCTAGAACTCATC
TATGCACCTAGTAGTCAACCTGACAATAAAAATGAAGTTAGAGAGTTCTGTAACTTAACTGCCTCCTCTCCTCTAGTTGGGGTTGTTTAA
TAA
Edits in Original Sequence 
(5')GAGGATACGACTATCAAAGAAGATTTGACTTTTGAAAGTGcACAAAAAAATTAGGACGATGAATCTTAGCCAATTGGATTGTGAAA
GTGCAtAAAATAAACGCAATTGATGAGAATATGAGCCATCTCCCTTTTGTTGATXTAAAAAGTCAATACAAGAGAGCAGAAGCCACCTGC
AGAACCCAGCTTCAAACACCTGTTAAGCTTATTCGGCCATCTTTGATTGTGTTAATAAAGGAAGGAGGCAATGGGATCAATGTTCAGTTC
ACCTCAGTTTAgCAAAGAACAAATGGAGGCCGCTCTTACCAAAGCCAAGCAGATCGTTTCCTCTAATCCTGTTGTCGTATTCAGTAAAAC
ATACTGCGGATATTGCACAAGGGTGAAGAAACTTCTTTCCCAGCTTGGTGCTACTTTTAAAGTTATTGAACTTGACCGGGAAAGTGATGG
AGATGAGGTTCAAGCAGCATTACTAGAATGGACTAAGCAGAGGACTGTGCCTAACGTGTTTATTGGGGGAGAACATGTTGGTGGCTGCGA
CAGCGTATTAGAGAAGCATCAACAGGGAAAGCTACTTCCCATGCTGAAGGACGCCGCTGCTATTCCCAACAATCCTGCCAAAGXTCTAGA
ACTCATCTATGCACtCTAGTAGTCAACCTGACAATAAAAATGAAGTTAGAGAGTTCTGTAACTTAACTGCCTCCTCTCCTCTAGTTGGGG
TTGTTTAATAA(3')GACGCTGGATTTCAAGTTCCTTTTTCTGAACATTTTCTTTTAGTACTATTTTCTATTTTTTACTTGCCATCTGTT
CCTTTGGGAAGTATATATTGTAGATTCGCGTTACAGATGCAGTTCTGTTTCCGGCAAGAGTAAATTCGTCACTTCTGAATTTATTTCTTC
CTTTACAAATTCACAATGGAGAAGACGATCGGAACTTGCACACGAGCTAATTTAAAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan