ESTScan Details for Unigene SGN-U586459

Score 
1395
Direction 
Forward
Predicted Peptide Sequence 
MLHFAXRPRQNNKEASTIDLNQYPSDNIRNFSIIAHVDHGKSTLADRLLELTGTIRKGHGQPQYLDKLQVERERGITVKAQTATMFHRHK
FLGSDTDFLLNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQGVQAQTVANFYLAFESNLAIIPVINKIDQPTADPDRVKTQLKSMFDL
NPSDVLLTSAKTGLGLEHVLPAAIERIPPPPGKNTSPLRMLLLDSYYDEYKGVICHVAIVDGALHKGDKICSAATGQSYEVSDVGIMHPE
LVATGILLTGQVGYIVSGMRSTKEARVGDTLHHTRTVIQPLPGFKPAKHMVFSGLYPADGSDFEALNHAIERLTCNDASVSVTKESSTAL
GXGFQMWFLGLTSHGCFSSALEQEHGAHVISTVPTVPYIFEYSDGSKLQIQNPAALPSNPKNRLTACWEPTVIATIIIPSEYVGSVITLC
AERRGEQLEYSFIDSQRAFMRYRMPLREIVVDFYNELKSITSGYASFDYEDSEYQASDLVKLDILLNGQPVDAMATIVHKSKAPRVGREL
VEKLKKFIDRQMFEIIIQAAIGSKVIARETLSAMRKNVLAKCYGGDXYKKEEVVGETERREEANEASGIRRYTPRGIPRVTQGLMKTILN
AFRFLLLVTKGK*
Predicted Coding Sequence 
ATGCTTCATTTTGCTXCTCGTCCTCGCCAAAACAATAAAGAAGCATCAACTATAGATTTGAATCAGTACCCTTCTGATAACATTCGTAAC
TTTTCAATTATTGCCCATGTTGATCATGGAAAATCAACCTTAGCTGACAGACTTCTCGAACTTACTGGAACCATTAGAAAAGGACATGGT
CAGCCTCAGTACTTAGATAAATTGCAGGTAGAGAGGGAACGGGGAATAACCGTTAAAGCCCAAACAGCAACTATGTTCCATCGTCACAAG
TTCCTTGGCAGTGACACAGATTTTTTGTTAAACCTTATTGACACACCTGGGCATGTGGATTTCAGCTATGAAGTATCCAGATCTTTGGCA
GCTTGTCAAGGTGCCCTTTTGGTTGTAGATGCAGCCCAAGGTGTGCAGGCACAGACTGTTGCTAATTTTTACCTCGCGTTTGAATCAAAC
CTGGCCATAATTCCTGTCATAAATAAAATTGATCAGCCCACTGCTGATCCAGATCGGGTAAAAACACAGCTCAAATCTATGTTTGACCTT
AATCCAAGCGATGTACTATTGACATCAGCAAAAACGGGTCTAGGTCTAGAGCATGTTCTTCCTGCTGCAATAGAGAGAATTCCTCCACCC
CCTGGTAAAAACACTTCACCTTTGCGAATGCTTTTGCTGGATTCATATTATGATGAGTACAAAGGAGTTATCTGCCATGTGGCTATTGTT
GATGGTGCTCTGCACAAGGGTGACAAGATTTGCTCTGCTGCGACTGGCCAAAGTTATGAAGTTTCTGATGTTGGTATCATGCACCCAGAA
CTTGTGGCAACAGGAATCCTTTTAACAGGTCAAGTTGGATATATAGTTAGCGGAATGCGTTCAACAAAAGAGGCCCGTGTTGGAGATACT
CTACATCATACACGAACAGTTATACAGCCCCTTCCAGGTTTCAAGCCAGCAAAACATATGGTCTTTTCTGGCCTATATCCAGCTGATGGA
TCTGATTTTGAGGCACTTAACCATGCCATAGAGAGACTGACGTGTAATGATGCCAGTGTCTCTGTAACTAAAGAAAGCAGCACAGCTCTA
GGTXCTGGGTTTCAGATGTGGTTTCTTGGGCTTACTTCACATGGATGTTTTTCATCAGCACTTGAGCAGGAACATGGAGCACATGTCATT
TCGACTGTTCCTACAGTGCCATATATTTTTGAGTACTCAGATGGAAGCAAATTACAGATCCAGAATCCTGCTGCTTTGCCTTCAAACCCC
AAAAATCGGCTCACTGCCTGCTGGGAACCTACTGTGATAGCAACTATTATAATCCCTAGTGAGTATGTGGGGTCTGTTATCACTTTATGT
GCTGAGCGTCGGGGGGAGCAATTGGAGTACTCATTTATTGATAGCCAGCGAGCTTTCATGAGGTATCGCATGCCTCTGAGGGAAATTGTT
GTGGACTTCTACAATGAATTGAAAAGTATAACATCAGGATATGCTTCGTTTGATTATGAGGATTCAGAATATCAGGCTTCAGATTTGGTG
AAGTTGGATATTCTCCTTAATGGCCAACCAGTTGATGCCATGGCAACCATTGTCCACAAATCAAAAGCTCCACGTGTCGGCCGCGAACTT
GTTGAGAAGCTTAAAAAGTTTATAGACAGGCAGATGTTTGAAATTATCATACAAGCTGCTATTGGATCTAAGGTCATCGCCCGGGAGACG
CTTTCTGCTATGAGAAAAAATGTTCTGGCAAAGTGTTATGGTGGTGATGXTTACAAGAAAGAGGAAGTTGTTGGAGAAACAGAAAGAAGG
GAAGAAGCGAATGAAGCGAGTGGGATCCGTCGATATACCCCAAGAGGCATTCCACGAGTTACTCAAGGTCTCATGAAGACTATCTTAAAT
GCCTTCAGATTTCTACTTCTAGTCACAAAAGGTAAATGA
Edits in Original Sequence 
CAAAGCCCTAATGTAAAACCCTCAGCTTTTTGGGTTCTTCAAACATAAATCGCGGGGAAATGACTACTTTCAAGAGAGCTTCAAAAGCTC
TCACATCCAAATTTTCTGCAATTTATACTTGCAATTTTCATCCGGTAACCTCTTTATCGCATTTTTCTTATACTCTTA
(5')ATGCTTCA
TTTTGCTXCTCGTCCTCGCCAAAACAATAAAGAAGCATCAACTATAGATTTGAATCAGTACCCTTCTGATAACATTCGTAACTTTTCAAT
TATTGCCCATGTTGATCATGGAAAATCAACCTTAGCTGACAGACTTCTCGAACTTACTGGAACCATTAGAAAAGGACATGGTCAGCCTCA
GTACTTAGATAAATTGCAGGTAGAGAGGGAACGGGGAATAACCGTTAAAGCCCAAACAGCAACTATGTTCCATCGTCACAAGTTCCTTGG
CAGTGACACAGATTTTTTGTTAAACCTTATTGACACACCTGGGCATGTGGATTTCAGCTATGAAGTATCCAGATCTTTGGCAGCTTGTCA
AGGTGCCCTTTTGGTTGTAGATGCAGCCCAAGGTGTGCAGGCACAGACTGTTGCTAATTTTTACCTCGCGTTTGAATCAAACCTGGCCAT
AATTCCTGTCATAAATAAAATTGATCAGCCCACTGCTGATCCAGATCGGGTAAAAACACAGCTCAAATCTATGTTTGACCTTAATCCAAG
CGATGTACTATTGACATCAGCAAAAACGGGTCTAGGTCTAGAGCATGTTCTTCCTGCTGCAATAGAGAGAATTCCTCCACCCCCTGGTAA
AAACACTTCACCTTTGCGAATGCTTTTGCTGGATTCATATTATGATGAGTACAAAGGAGTTATCTGCCATGTGGCTATTGTTGATGGTGC
TCTGCACAAGGGTGACAAGATTTGCTCTGCTGCGACTGGCCAAAGTTATGAAGTTTCTGATGTTGGTATCATGCACCCAGAACTTGTGGC
AACAGGAATCCTTTTAACAGGTCAAGTTGGATATATAGTTAGCGGAATGCGTTCAACAAAAGAGGCCCGTGTTGGAGATACTCTACATCA
TACACGAACAGTTATACAGCCCCTTCCAGGTTTCAAGCCAGCAAAACATATGGTCTTTTCTGGCCTATATCCAGCTGATGGATCTGATTT
TGAGGCACTTAACCATGCCATAGAGAGACTGACGTGTAATGATGCCAGTGTCTCTGTAACTAAAGAAAGCAGCACAGCTCTAGGTXCTGG
GTTTCAGATGTGGTTTCTTGGGCTTACTTCACATGGATGTTTTTCATCAGCgACTTGAGCAGGAACATGGAGCACATGTCATTTCGACTG
TTCCTACAGTGCCATATATTTTTGAGTACTCAGATGGAAGCAAATTACAGATCCAGAATCCTGCTGCTTTGCCTTCAAACCCCAAAAATC
GGCTCACTGCCTGCTGGGAACCTACTGTGATAGCAACTATTATAATCCCTAGTGAGTATGTGGGGTCTGTTATCACTTTATGTGCTGAGC
GTCGGGGGGAGCAATTGGAGTACTCATTTATTGATAGCCAGCGAGCTTTCATGAGGTATCGCATGCCTCTGAGGGAAATTGTTGTGGACT
TCTACAATGAATTGAAAAGTATAACATCAGGATATGCTTCGTTTGATTATGAGGATTCAGAATATCAGGCTTCAGATTTGGTGAAGTTGG
ATATTCTCCTTAATGGCCAACCAGTTGATGCCATGGCAACCATTGTCCACAAATCAAAAGCTCCACGTGTCGGCCGCGAACTTGTTGAGA
AGCTTAAAAAGTTTATAGACAGGCAGATGTTTGAAATTATCATACAAGCTGCTATTGGATCTAAGGTCATCGCCCGGGAGACGCTTTCTG
CTATGAGAAAAAATGTTCTGGCAAAGTGTTATGGTGGTGATGXTTACAAGAAAGAGGAAGTTGTTGGAGAAACAGAAAGAAGGGAAGAAG
CGAATGAAGCGAGTGGGATCCGTCGATATACCCCAAGAGGCATTCCACGAGTTACTCAAGGTCTCATGAAGACTATCTTAAATGCCTTCt
AGATTTCTACTTCTAGTCACAAAAGGTAAATGA(3')AGGATTCCCCTCTATTTCTTCCCAGTTAGTAAGTGTATTTGTTTTGTCCCTTT
AGGGGCAGGTTCTTGATAATTGAATATTGATAGAAGTTTTAGCAGACAGGCGAGACGCTGATGAATAGAAAATGGGAACACTAGACTGAA
CGAGAAAGTGTATCACAGGATTTAAACTCTTGTCTTGTGAAAAATTAGTTTGGAGTAGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan