ESTScan Details for Unigene SGN-U586912

Score 
142
Direction 
Reverse
Predicted Peptide Sequence 
XRQCGVEGTTVNLGLWDTAGQEDYNRLRPLSYPGADVFVLAFSLVSRASYENILKKWIPELQHYAPGIPVVLAGTKLDLREDKHFLADHP
GLVPVTTAQGEDASGNKLVLPNISNVAXKPQQNVKAVFDAAIKVVIKPPQKQKEKKKQXSGMSHECDVRKEARLFKVPTQCTYFPSIRSL
ADHISGLSALLTKLGFYDNFYDENNVFVYLQSNLLLDGLDLSLVKIYIGTRLNASDATNSATP
Predicted Coding Sequence 
XXGCGCCAATGTGGTGTGGAAGGGACCACAGTAAATTTAGGTCTCTGGGATACTGCAGGACAAGAAGATTATAACAGATTAAGGCCACTG
AGCTACCCAGGAGCAGATGTTTTTGTCCTAGCGTTCTCCTTGGTGAGTCGTGCAAGCTATGAAAACATACTTAAGAAGTGGATTCCCGAA
CTTCAGCATTATGCTCCTGGAATTCCGGTGGTATTAGCTGGCACCAAACTTGATCTTCGTGAGGATAAGCACTTCTTGGCTGATCATCCT
GGACTAGTTCCTGTCACCACTGCGCAGGGAGAGGACGCTAGCGGAAACAAATTGGTGCTGCCTAATATATCGAATGTAGCTXCTAAACCA
CAACAGAATGTGAAAGCTGTATTTGATGCTGCAATCAAGGTCGTCATCAAGCCACCACAAAAGCAAAAGGAGAAGAAAAAACAAXCGTCG
GGGATGTCTCATGAATGTGATGTGCGCAAGGAAGCTCGTTTGTTTAAAGTGCCAACTCAATGTACATACTTCCCATCAATTCGGTCTTTA
GCTGATCATATCAGTGGCTTGAGTGCACTGCTTACAAAACTTGGTTTCTATGATAACTTTTATGACGAGAATAATGTATTTGTTTATCTG
CAGTCCAACTTGTTGCTGGACGGACTTGATTTGTCACTTGTAAAAATTTACATCGGTACTAGGTTAAATGCAAGTGATGCGACTAATTCT
GCTACACCT
Edits in Original Sequence 
(5')XXGCGCCAATGTGGTGTGGAAGGGACCACAGTAAATTTAGGTCTCTGGGATACTGCAGGACAAGAAGATTATAACAGATTAAGGCC
ACTGAGCTACCCAGGAGCAGATGTTTTTGTCCTAGCGTTCTCCTTGGTGAGTCGTGCAAGCTATGAAAACATACTTAAGAAGTGGATTCC
CGAACTTCAGCATTATGCTCCTGGAATTCCGGTGGTATTAGCTGGCACCAAACTTGATCTTCGTGAGGATAAGCACTTCTTGGCTGATCA
TCCTGGACTAGTTCCTGTCACCACTGCGCAGGGAGAGGACGCTAGCGGAAACAAATTGGTGCTGCCTAATATATCGAATGTAGCTXCTAA
ACCACAACAGAATGTGAAAGCTGTATTTGATGCTGCAATCAAGGTCGTCATCAAGCCACCACAAAAGCAAAAGGAGAAGAAAAAACAAXC
GTCGGGGATGTCTCATGtAATGTGATGTGCGCAAGGAAGCTCGTTTGTTTAAAGTGCCAACTCAATGTACATACTTCCCATCAATTCGGT
CTTTAGCaTGATCATATCAGTGGCTTGAGTGCACTGCTTACAAAACTTaGGTTTCTATGATAACTTTTATGACGAGAATAATGTATTTGT
TTATCTGCAGTCCAACTTGTTGCTGGACGGACTTGATTTGTCACTTGTAAAAATTTACATCGGTACTAGGTTAAATGCAAGTaGATGCGA
CTAATTCTGCTACACCT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan