ESTScan Details for Unigene SGN-U587008

Score 
511
Direction 
Forward
Predicted Peptide Sequence 
MDFRIIVANPRMIPGSQNCGSFKGAQALCIDLKEEKMWSIKTGVKCSWLLPFTSSVKGLIAYMFSPLVRPGAPPLSKKSRTYMLVDVFSS
SAAVTVDQKLLIIIDTGCLMDKLNDFVLGADFTASLRHKMFLSFSNKFQDHRLPKYDQTDQMIFLVKFCPSILETLLDLFLGLSCPCTKT
LLKFSKEGGAMKMKMASRALALTDLAP*
Predicted Coding Sequence 
ATGGATTTCCGAATCATTGTTGCXAATCCAAGAATGATACCGGGAAGTCAAAATTGTGGTTCTTTCAAAGGGGCTCAAGCCCTCTGCATC
GACTTAAAGGAAGAGAAGATGTGGTCAATCAAAACTGGTGTTAAGTGCAGCTGGTTGTTACCATTTACATCATCAGTCAAAGGATTGATA
GCATACATGTTTAGTCCTCTTGTCCGTCCAGGGGCTCCTCCTTTGAGCAAAAAGTCCAGAACGTACATGTTAGTTGATGTATTTTCATCT
TCTGCAGCAGTXACAGTTGATCAGAAGCTTTTGATCATCATTGACACTGGATGTTTGATGGACAAGTTGAATGATTTTGTCTTAGGAGCA
GATTTCACAGCTTCTCTTAGACACAAAATGTTCTTGAGTTTCTCAAACAAGTTTCAAGATCATCGTTTACCAAAATATGATCAAACAGAC
CAGATGATTTTCCTTGTCAAGTTCTGCCCTAGCATTCTGGAGACGCTTTTGGATTTGTTCCTCGGTCTCAGTTGCCCTTGCACGAAGACG
CTTCTCAAGTTCTCAAAAGAAGGAGGAGCAATGAAAATGAAAATGGCTTCAAGAGCGCTAGCTCTCACAGACCTTGCTCCTTGA
Edits in Original Sequence 
AGAAGAAACGAAACCAAATAGATAAAAGAACGAAAAGCATCCTATCCAACATATGTTTTCTTTGAATATAGTAAACTAAC(5')ATGGAT
TTCCGAATCATTGTTGCXAATCCAAGAATGATACCGGGAAGTCAAAATTGTGGTTCTTTCAAAGGGGCTCAAGCCCTCTGCATCGACTTA
AAGGAAGAGAAGATGTGGTCAATCAAAACTGGaTGTTAAGTGCAGCTGGTTGTTACCATTTACATCATCAGTCAAAGGATTGATAGCATA
CATGTTTAGTCCTCTTGTCCGTCCAGGGGCTCCTCCTTTGAGCAAAAAGTCCAGAACGTACATGTTAGTTGATGTATTTTCATCTTCTGC
AGCAGTXACAGTTGATCAGAAGCTTTTGATCgATCATTGACACTGGATGTTTGATGGACAAGTTGAATGATTTTGTCTTAGGAGCAGATT
TCACAGCTTCTCTTAGACACAAAATGTTCTTGAGTTTCTCAtAACAAGTTTCAAGATCATCGTTTACCAAAATATGATCAAACAGACCAG
ATGATTTTCCTTGtTCAAGTTCTGCCCTAGCATTCTGGAGACGCTTTTGGATTTGTTCCTCGGTCTCAGTTGCCCTTGCACGAAGACGCT
TCTCAAGTTCgTCAAAAGAAGGAGGAGCAATGAAAATGAAAATGGCTTCAAGAGCGCTAGCTCTCACAGACCTTGCTCCTTGA(3')ACA
TCGATATCAAGGATACATCGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan