ESTScan Details for Unigene SGN-U587176

Score 
27
Direction 
Reverse
Predicted Peptide Sequence 
SMLDFLPXPAQSAPPRFMGRGFDRMGYSEAGQSSXGVRVTDGQEFEPVEATFASVSHCGKSHPGECRWATGGVFLAAVRAXTMRECHLRG
SAGGMAQPTGSVAGSFSSVAMRPTGQGIQAPAGHGRGRGGASSSSSASNRIYALTNXAGSGGVT*
Predicted Coding Sequence 
AGCATGTTAGATTTTCTTCCCAXGCCAGCACAGAGTGCACCCCCACGTTTCATGGGTAGGGGGTTCGATCGTATGGGATATTCAGAAGCT
GGTCAGAGCTCTAGXGGCGTTAGGGTCACAGATGGGCAGGAGTTTGAGCCAGTCGAGGCCACCTTTGCCTCAGTTTCTCATTGTGGTAAG
TCCCATCCTGGGGAATGTCGTTGGGCTACAGGTGGTGTTTTTCTTGCGGCCGTCAGGGCCATXACTATGAGGGAGTGTCACCTTAGAGGT
AGTGCAGGTGGTATGGCACAGCCTACAGGGTCCGTTGCTGGTTCATTTTCTTCTGTGGCTATGCGCCCTACGGGGCAGGGTATTCAGGCG
CCAGCAGGCCATGGTAGAGGACGTGGTGGAGCTTCCAGTTCTAGCAGTGCCTCGAACCGTATATATGCTTTGACTAATAXGGCAGGATCA
GGGGGTGTCACCTAA
Edits in Original Sequence 
(5')AGCATGTTAGATTTTCTTCCCAXGCCAGCACAGAGTGCACCCCCACGTTTCATGGGTAGGGGGTTCGATCGTATGGGATATTCAGA
AGCTGGTCAGAGCTCTAGXGGCGTTAGGGTCACAGATGGGCAGGAGTTTGAGCCAGTCGAGGCCACCTTTGCCTCAGTgTTCTCATTGTG
GTAAGTCCCATCCTGGGGAATGTCGTTGGGCTACAGGTGcGTGTTTTTCTTGCGGCCGTCAGGGCCATXACTATGAGGGAGTGTCACCTT
AGAGGTAGTGCAGGTGGTATGGCACAGCCTACAGGGTCCGTTGCTGGTTCATTTTCTTCTGTGGCTATGCGCCCTACGGGGCAGGGTATT
CAGGCGCCAGCAGGCCATGGTAGAGGACGTGGTGGAGCTTCCAGTTCTAGCAGTGCCTCGAACCGTATATATGCTTTGACTAATAXGGCA
GGATCAGGGGGTGTCACCTAA(3')TGTGATCACAGGTATATTATCACTATTCTCCCGAAGTGTGTATACATTGATAGACCCAGGTTCCA
CCTTATCATATATATCTCCCTTTGTTGCTAGTAGGATCGGAATAGAGTATGAGTTGATAGAACCATTTGAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan