ESTScan Details for Unigene SGN-U587616

Score 
111
Direction 
Reverse
Predicted Peptide Sequence 
MTSYQIYVTVSPLVRSVVVAAASAEKTLAVNCFLLRLWAIAXSSLMPQMIVWHKLSGHWYILQNPGKTERSTIPLGKSAIXLQQCKPTSS
GPLVIHHYKGLVERILQ
Predicted Coding Sequence 
ATGACATCTTACCAGATTTATGTAACAGTTTCTCCTCTAGTTCGCTCTGTTGTGGTTGCAGCTGCCTCCGCGGAAAAAACATTAGCTGTT
AACTGTTTTCTCCTCCGCTTATGGGCAATAGCTGXTTCTTCTTTGATGCCTCAGATGATAGTATGGCACAAACTAAGCGGACACTGGTAC
ATACTTCAAAATCCCGGTAAAACTGAAAGATCTACTATTCCCCTTGGCAAGTCTGCTATTXTTCTTCAGCAGTGCAAGCCCACTTCTTCT
GGCCCGTTGGTCATCCACCATTACAAAGGCCTCGTTGAAAGAATCCTCCAG
Edits in Original Sequence 
TTGTTGAACTTAAAACACAATGATATATATTCCTCAGGCAATGTGAACATACAAGCGATAGTTCATTTTATTATTCATTCACTTGTTACA
TACTTGTACAACAGTCAAAATT
(5')ATGACATCgTTACCAGATTTATGTAACAGTTTCTCCTCTAGTTCGCTCTGTTGTGGTTGCAGCT
GCCTCCGCGGAAAAAACATTAGtCTGTTAACTGTTTTCTCCTCCGCTTATGGGCAATAGCTGXTTCTTCTTTGATGCCTCAGATGATAGT
ATGGCACAAACTAAGCGGACACTGGTACATACTTCAAAATCCCGGTAAAACTGAAAGATCTACTATTCCCCTTGGCAAGTCTGCTATTXT
TCTTCAGCAGTGCAAGCCCACTTCTTCTGGCCCGTTGGTCATCCACCATTACAAAGGCCTCGTTGAAAGAATCCTCCAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan