ESTScan Details for Unigene SGN-U587809

Score 
534
Direction 
Forward
Predicted Peptide Sequence 
MASSDHHMHDHHHHDHDHDHDHTHQDTKATSWVGADGKVYHSHDGLAPHSHEPIYSPGYFSRRAPPLNDRNFSERAFTIGIGGPVGTGKT
ALMLALCKVLREKYSLAAVTNDIFTKEDGEFLIKHGALPEERIRAVETGGCPHAAIREDISINLGPL
Predicted Coding Sequence 
ATGGCTTCTTCAGACCACCATATGCATGACCACCACCATCATGACCATGACCATGACCATGACCATACCCATCAGGACACAAAAGCAACA
TCATGGGTAGGAGCAGATGGGAAAGTATACCATAGTCATGATGGGTTGGCTCCTCACTCTCATGAACCTATTTATTCACCTGGCTACTTT
AGCAGAAGGGCACCTCCACTTAATGACAGGAATTTCAGTGAAAGAGCCTTTACTATTGGAATTGGTGGCCCTGTTGGTACTGGGAAAACA
GCTTTAATGCTGGCATTATGTAAAGTCTTGAGGGAAAAATACAGTCTTGCAGCAGTAACAAATGATATATTCACGAAAGAAGATGGAGAG
TTCTTAATAAAACATGGTGCATTGCCGGAGGAAAGGATTCGAGCAGTGGAGACAGGAGGATGCCCACATGCTGCTATTAGGGAAGATATA
AGCATTAACCTTGGACCTCTX
Edits in Original Sequence 
TTTTATCTCCCCTGTACCCTTGAGATACCCTCTTTGACTCTGAGAATCTCCACTCAA(5')ATGGCTTCTTCAGACCACCATATGCATGA
CCACCACCATCATGACCATGACCATGACCATGACCATACCCATCAGGACACAAAAGCAACATCATGGGTAGGAGCAGATGGGAAAGTATA
CCATAGTCATGATGGGTTGGCTCCTCACTCTCATGAACCTATTTATTCACCTGGCTACTTTAGCAGAAGGGCACCTCCACTTAATGACAG
GAATTTCAGTGAAAGAGCCTTTACTATTGGAATTGGTGGCCCTGTTGGTACTGGGAAAACAGCTTTAATGCTGGCATTATGTAAAGTCTT
GAGGGAAAAATACAGTCTTGCAGCAGTAACAAATGATATATTCACGAAAGAAGATGGAGAGTTCTTAATAAAACATGGTGCATTGCCGGA
GGAAAGGATTCGAGCAGTGGAGACAGGAGGATGCCCACATGCTGCTATTAGGGAAGATATAAGCATTAACCTTGGACCTCTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan