Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U587984

Score 
204
Direction 
Reverse
Predicted Peptide Sequence 
MDNNKHPDPRIESLNEXGLNDXDIFDAGIPFGGYKMSGMGREKGIYSLNKYLQVKAVVTPLKNPAW
Predicted Coding Sequence 
ATGGACAATAACAAACACCCTGACCCGAGGATTGAGAGTTTGAACGAAGXTGGGTTAAATGATAXAGATATATTTGATGCTGGAATTCCT
TTTGGAGGGTACAAGATGAGTGGCATGGGCAGGGAAAAGGGTATTTACAGCCTTAACAAATACTTACAAGTGAAGGCTGTTGTTACTCCA
TTGAAGAATCCAGCTTGG
Edits in Original Sequence 
AAAAAAAAATTTCCACCCCTC(5')ATGGACAATAACAAACACCCTGACCCGAGGATTGAGAGTTTGAACGAAGXTGGGTTAAATGATAX
AGATATATTTGATGCTGGAATTCCTTTTGGAGGGTACAAGATGAGTGGCATGGGCAGGGAAAAGGGTATTTACAGCCTTAACAAATACTT
ACAAGTGAAGGCTGTTGTTACTCCATTGAAGAATCCAGCTTGG(3')ATATAGATTGGGCACCCCTGATTTTAAAATCATAGTACTACTG
TTTTTGTAAAATGACATGGTTGTTTACATGACATTGTTAGGGGCAATCAATAAAGTTTTCATTTGGTTGTTGTTTTGTAGAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan