Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U588617

Score 
350
Direction 
Forward
Predicted Peptide Sequence 
RFETGATSELNAMSSPWPFVAWGMDVISSIESTASNGHRFILVAIDYFTKWVEATPYKSVTKKVVVDFVRNNLICRFGVPESIITDNGAN
LNSHLMKQIYEQFKLFIESXTAYRPQMNRAVEAANKNIKKILRKMIDKQRGWHEMLPYAFLGYRTTVRTSTWATPYLLVYGTEAVVPVEV
EIPSLRIIQEAELSNAEWLSKQIDQLALIDKKRIVAFAMASCTDRXMTRAFHKRVRARNFEVGQLVLKRIFPHQDEYKEX
Predicted Coding Sequence 
CGTTTTGAGACGGGTGCCACCTCAGAACTTAACGCTATGAGTTCACCTTGGCCATTTGTAGCTTGGGGAATGGATGTCATCAGTTCTATA
GAGTCTACCGCTTCTAATGGACATAGATTCATTTTGGTTGCCATTGATTATTTCACCAAGTGGGTGGAAGCAACCCCTTACAAGTCGGTA
ACCAAGAAAGTGGTGGTCGATTTTGTTCGCAACAATCTGATATGCAGATTTGGAGTTCCAGAATCCATCATTACTGATAACGGGGCAAAT
CTCAACAGTCATTTGATGAAACAGATATATGAACAATTTAAGTTATTCATCGAAAGTXCAACTGCTTATCGCCCCCAAATGAACAGAGCT
GTAGAAGCCGCCAACAAAAATATCAAGAAGATTTTGAGGAAAATGATTGACAAACAGCGGGGTTGGCATGAAATGTTGCCATATGCTTTT
CTAGGTTATCGAACGACGGTCAGAACATCGACTTGGGCTACTCCATACTTGCTAGTATATGGAACAGAGGCAGTCGTGCCTGTTGAAGTC
GAGATACCGTCATTGCGGATCATCCAAGAAGCTGAATTAAGTAACGCCGAATGGCTTAGCAAACAGATTGATCAACTAGCCTTAATTGAT
AAGAAGAGAATAGTTGCGTTTGCCATGGCAAGTTGTACAGACAGAGAXATGACTCGCGCTTTTCACAAAAGAGTAAGAGCCAGGAATTTT
GAAGTTGGTCAGTTGGTTCTTAAGCGTATTTTTCCTCATCAAGACGAGTACAAAGAAAXX
Edits in Original Sequence 
(5')CGTTTTGAGACGGGTGCCACCTCAcGAACTTAACGCTATGAGTTCACCTTGGCCATTTGTAGCTTGGGGAATGGATGTCATCAGTT
CTATAGAGTCTACCGCTTCTAATGGACATAGATTCATTTTGGTTGCCATTGATTATTTCACCAAGTGGGTGGAAGCAACCCCTTACAAGT
CGGTAACCAAGAAAGTGGTGGTCGATTTTGTTCGCAACAATCTGATATGCAGATTTGGAGTTCCAGAATCCATCATTACTGATAACGGGG
CAAATCTCAACAGTCATTTGATGAAACAGATATATGAACAATTTAAGTTATTCATCGAAAGTXCAACTGCTTATCGCCCCCAAATGAACA
GAGCTGTAGAAGCCGCCAACAAAAATATCAAGAAGATTTTGAGGAAAATGATTGACAAACAGCGGGGTTGGCATGAAATGTTGCCATATG
CTTTTCTAGGTTATCGAACGACGGTCAGAACATCGACTTGGGCTACTCCATACTTGCTAGTATATGGAACAGAGGCAGTCGTGCCTGTTG
AAGTCGAGATACCGTCATTGCGGATCATCCAAGAAGCTGAATTAAGTAACGCCGAATGGCTTAGCAAACAGATTGATCAACTAGCCTTAA
TTGATAAGAAGAGAATAGTTGCGTTTGCCATGGCAAGTTGTACAGACAGAGAXATGACTCGCGCTTTTCACAAAAGAGTAAGAGCCAGGA
ATTTTGAAGTTGGTCAGTTGGTTCTTAAGCGTATTTTTCCTCATCAAGACGAGTACAAAGAAAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan