ESTScan Details for Unigene SGN-U589412

Score 
222
Direction 
Reverse
Predicted Peptide Sequence 
MAAARAALKLGSLVKEEAICSMIYC*ISGELTLRVLEFLVSSWDLGLVRSRVIVGPDELRDVEHGTEPSVTHRVEFGGVDPFLMDVGDCA
PPHKLLQE*
Predicted Coding Sequence 
ATGGCGGCTGCAAGGGCTGCTTTGAAACTCGGATCTTTGGTCAAGGAAGAAGCCATTTGTTCTATGATATACTGTTGAATTTCTGGTGAA
TTAACCTTGCGAGTACTTGAATTTCTTGTTTCTTCATGGGATTTAGGCTTGGTAAGGTCCAGGGTAATTGTTGGTCCAGATGAGCTGAGA
GATGTTGAGCATGGGACTGAACCAAGTGTTACACATCGGGTAGAGTTCGGGGGTGTTGATCCATTTTTGATGGATGTGGGTGATTGTGCT
CCCCCTCATAAGTTGCTACAAGAATAG
Edits in Original Sequence 
TTCAGAATCTTCAACTAAACAAGTGGTGTATTTTAGGTGGCTGAATCAGCTGCCTTTTGGGCTTTAGTTGAGGCAGCCCATATTACAACT
TGAATTAATCCCACTTCCCCTTTAACCCATCATATATTTTTTTGTCCGAAGGATGAAGCTCGCCTACCATACTATCAACTTCAAATTTTC
TAATGTGGTATATACATCAAATTGGCCCTTCGATCCTCAACTAGTCAAATACAAGCAAATTGACAACAACCCTTGACTAGATTCCACTAC
TATTTCCTTCTTTACCACTTCTCTGTCTGATTATGCTGGAGAAATTTTCCCGAT
(5')ATGGCGGCTGCAAGGGCTGCTTTGAAACTCGG
ATCTTTGGTCAAGGAAGAAGCCATTTGTTCTATGATATACTGTTGAATTTCTGGTGAATTAACCTTGCGAGTACTTGAATTTCTTGTTTC
TTCATGGGATTTAGGCTTGGTAAGGTCCAGGGTAATTGTTGGTCCAGATGAGCTGAGAGATGTTGAGCATGGGACTGAACCAAGTGTTAC
ACATCGGGTAGAGTTCGGGGGTGtTTGATCCATTTTTGATGGATGTGGGTGATTGTGCTCCCCCTCATAAGTTGCTACAAGAATAG(3')
ATTGATCTTCCACACTTCTTTGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan