ESTScan Details for Unigene SGN-U589619

Score 
400
Direction 
Forward
Predicted Peptide Sequence 
ASVPAVTKNDGSNKREPEVMVSGQGTEKSGASSSKSEDSLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIR
ERTKELKADAKLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIRMG*
Predicted Coding Sequence 
GCAAGTGTACCAGCTGTCACTAAGAATGATGGGAGTAATAAGAGGGAGCCTGAGGTTATGGTTTCAGGGCAAGGAACAGAAAAATCTGGT
GCTTCTTCAAGCAAGAGTGAAGACAGCCTCCGGTCTCCTATTTGCTGTATCATGGGTCATGTTGATACTGGTAAAACCAAGCTTCTTGAC
TGCATACGAGGCACTAATGTCCAAGAAGGTGAAGCTGGAGGGATTACACAGCAGATAGGTGCAACTTATTTTCCAGCTGAGAATATAAGG
GAGAGAACAAAGGAACTAAAAGCTGATGCCAAGCTGAAGGTGCCTGGATTGTTGGTCATAGACACACCTGGCCATGAATCATTCACTAAT
TTGCGTTCTCGGGGTTCAGGTTTATGTGATATTGCAATTTTGGTTGTGGACATTCGCATGGGTTAG
Edits in Original Sequence 
(5')GCAAGTGTACCAGCTGTCACTAAGAATGATGGGAGTAATAAGAGGGAGCCTGAGGTTATGGTTTCAGGGCAAGGAACAGAAAAATC
TGGTGCTTCTTCAAGCAAGAGTGAAGACAGCCTCCGGTCTCCTATTTGCTGTATCATGGGTCATGTTGATACTGGTAAAACCAAGCTTCT
TGACTGCATACGAGGCACTAATGTCCAAGAAGGTGAAGCTGGAGGGATTACACAGCAGATAGGTGCAACTTATTTTCCAGCTGAGAATAT
AAGGGAGAGAACAAAGGAACTAAAAGCTGATGCCAAGCTGAAGGTGCCTGGATTGTTGGTCATAGACACACCTGGCCATGAATCATTCAC
TAATTTGCGTTCTCGGGGTTCAGGTTTATGTGATATTGCAATTTTGGTTGTGGACATTaCGCATGGGTTAG(3')AACCGCAGACTATCG
AGTCGCTTAATCTTCTAAAGATGAGGAATACAGAATTTGTTGTTGCTCTGAACAAGATAGATAGGCTTTATGGATGGAAAGTGTGCCGCA
ATGCACCTATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan