ESTScan Details for Unigene SGN-U589759

Score 
347
Direction 
Forward
Predicted Peptide Sequence 
XSADNSVRLFDRRNLTSDGVGSPVHMFEHHTAAVLCVQWCPNRSSVFGSCAEDGLLNIWDYEKXLVDXSSQVGAAKDSDIESDEDEEESP
PGLFFQHAGHRDKIVDFHWNACDPWTIVSVSDDAETSGGGGTLQIWRMIDMLYRPKAEVLAEMQHF
Predicted Coding Sequence 
XGGTCCGCTGATAATTCAGTACGCTTATTTGACCGGCGAAATTTGACTTCAGATGGGGTTGGGTCACCAGTACATATGTTTGAACATCAC
ACAGCTGCAGTTCTCTGTGTTCAGTGGTGTCCGAATAGGTCTTCTGTGTTTGGGAGCTGTGCAGAGGATGGTCTCTTAAATATTTGGGAC
TATGAGAAGXTTTTAGTTGATTXTTCTTCACAGGTTGGCGCAGCAAAAGATTCTGATATTGAATCTGATGAAGATGAAGAGGAGTCTCCT
CCAGGCTTGTTTTTTCAGCATGCTGGCCACAGGGATAAGATTGTGGACTTTCACTGGAATGCTTGTGATCCATGGACTATTGTTAGTGTA
TCTGATGATGCAGAGACCTCTGGTGGAGGGGGCACATTACAGATATGGCGTATGATTGATATGTTGTACCGGCCGAAGGCTGAAGTTTTG
GCTGAGATGCAACATTTC
Edits in Original Sequence 
(5')XGGTCCGCTGATAATTCAGTACGCTTATTTGACCGGCGAAATTTGACTTCAGATGGGGTTGGGTCACCAGTACATATGTTTGAACA
TCACACAGCTGCAGTTCTCTGTGTTCAGTGGTGTCCGAATAGGTCTTCTGTGTTTGGGAGCTGTGCAGAGGATGGTCTCTTAAATATTTG
GGACTATGAGAAGXTTTTAGTTGATTXTTCTTCACAGGTTGGCGCAGCAAAAGATTCTGATATTGAATCTGATGAAGATGAAGAGGAGTC
TCCTCCAGGCTTGTTTTTTCAGCATGCTGGCCACAGGGATAAGATTGTGGACTTTCACTGGAATGCTTGTGATCCATGGACTATTGTTAG
TGTATCTGATGATGCAGAGACCTCTGGTGGAGGGGGCACATTACAGATATGGCGTATGATTGATATGTTGTACCGGCCGAAGGCTGAAGT
TTTGGCTGAGATGCAACATTTC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan