ESTScan Details for Unigene SGN-U589926

Score 
94
Direction 
Forward
Predicted Peptide Sequence 
XFSRLFANKEMRILMVGLDAAGXNHHIVQAQAGEIVTTIPTIGYNVETVEYKSISLKSWDVRGSRQYHTI
Predicted Coding Sequence 
XTTTTCAGCCGGCTGTTTGCCAACAAGGAGATGCGTATTCTGATGGTTGGTCTCGATGCAGCTGGTAAXAACCACCATATTGTACAAGCT
CAAGCTGGAGAGATTGTTACCACCATTCCTACCATTGGATACAATGTGGAGACTGTTGAATACAAAAGCATAAGCTTGAAAAGCTGGGAT
GTTCGGGGGTCAAGACAATATCATACCATT
Edits in Original Sequence 
(5')XTTTTCAGCCGGCTGTTTGCCAACAAGGAGATGCGTATTCTGATGGTTGGTCTCGATGCAGCTGGTAAXAACCACCATATTGTACA
AGCTCAAGCTGtGAGAGATTGTTACCACCATTCCTACCATTGGATACAATGTGGAGACTGTTGAATACAAAAGCATAAGCTTGAAAAGCT
GGGATGTTCGGGGGTCAAGACAATATCATACCATT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan