ESTScan Details for Unigene SGN-U589950

Score 
345
Direction 
Forward
Predicted Peptide Sequence 
XVAIEPKTKADIDKMAQGLIKLAQEDPSFHFSRDEEINQTVIEGMGELHLEIIVDRLKREFKVEANVGAPQVNYRESISRNSEVKYVHKK
QSGGSGQFADITVRFEPMEAGGGYEFKSEIKGGAVPKEYIPGVMKGLEECMSNGVLAGFPVVDVRAVLVDGSYHDVDSSVLAFQLAARGA
FREGMRKAGPQLQYLARNDKGAASYVMQLAKFDVVPQHIXKPACXKGGSSCCLVSHLPDFGSTNLKIGIFLDEDVKAWTTFFLYVPAWNT
DGEXADIYHASEFFQTFVYVGELX
Predicted Coding Sequence 
XXGGTTGCAATTGAACCTAAGACCAAGGCAGACATTGATAAGATGGCGCAAGGTTTAATAAAACTGGCACAAGAGGATCCGTCTTTCCAT
TTTTCACGTGATGAGGAGATTAACCAGACAGTTATTGAGGGAATGGGAGAATTACATCTTGAGATCATTGTAGATCGACTGAAAAGGGAA
TTTAAGGTGGAAGCTAATGTCGGAGCTCCACAAGTCAACTACCGCGAGAGCATTTCCAGGAACTCAGAAGTAAAATACGTGCATAAGAAG
CAGTCTGGTGGTTCAGGACAGTTTGCTGATATCACAGTAAGGTTTGAACCCATGGAAGCAGGTGGTGGATATGAATTCAAGAGTGAAATC
AAGGGAGGTGCAGTGCCAAAAGAATATATCCCTGGTGTTATGAAGGGATTAGAAGAATGCATGAGTAACGGAGTACTGGCAGGCTTTCCA
GTTGTTGATGTTCGTGCTGTGCTAGTAGATGGATCTTACCATGATGTGGATTCAAGTGTTTTGGCATTCCAGCTGGCTGCTCGGGGAGCT
TTTAGGGAAGGGATGAGAAAAGCTGGTCCACAATTGCAGTACCTTGCGAGGAATGACAAAGGGGCTGCATCGTATGTTATGCAGTTAGCC
AAATTTGACGTTGTCCCTCAACACATTXCAAAACCAGCTTGCCNAAAAGGAGGAAGCAGCTGCTGCTTAGTCAGTCATCTTCCAGATTTT
GGATCCACAAACTTGAAAATAGGTATTTTTCTCGACGAAGATGTTAAGGCTTGGACAACATTCTTTTTGTACGTACCAGCATGGAACACC
GATGGAGAAXTAGCTGATATTTATCATGCGTCTGAGTTTTTTCAAACGTTTGTGTATGTTGGTGAATTATXX
Edits in Original Sequence 
(5')XXGGTTGCAATTGAACCTAAGACCAAGGCAGACATTGATAAGATGGCGCAAGGTTTAATAAAACTGGCACAAGAGGATCCGTCTTT
CCATTTTTCACGTGATGAGGAGATTAACCAGACAGTTATTGAGGGAATGGGAGAATTACATCTTGAGATCATTGTAGATCGACTGAAAAG
GGAATTTAAGGTGGAAGCTAATGTCGGAGCTCCACAAGTCAACTACCGCGAGAGCATTTCCAGGAACTCAGAAGTAAAATACGTGCATAA
GAAGCAGTCTGGTGGTTCAGGACAGTTTGCTGATATCACAGTAAGGTTTGAACCCATGGAAGCAGGTGGTGGATATGAATTCAAGAGTGA
AATCAAGGGAGGTGCAGTGCCAAAAGAATATATCCCTGGTGTTATGAAGGGATTAGAAGAATGCATGAGTAACGGAGTACTGGCAGGCTT
TCCAGTTGTTGATGTTCGTGCTGTGCTAGTAGATGGATCTTACCATGATGTGGATTCAAGTGTTTTGGCATTCCAGCTGGCTGCTCGGGG
AGCTTTTAGGGAAGGGATGAGAAAAGCTGGTCCACAATTGCtAGTACCTTGCGAGGAATGACAAAGGGGCgTGCATCGTATGTTATGCAG
TTAGCCAAATTTGACGTTGTCCCTCAACACATTXCAAAACCAGCTTGCCNAAAAGGAGGAAGCAGCTGCTGCTTAGTCAGTCATCTTCCA
GATTTTGGATCCACAAACTTGAAAATAGGTATTTTTaCTCGACGAAGATGTTAAGGCTTGGACAACATTCTTTTTGTACGTACCAGCATG
GAACACCGATGGAGAAXTAGCTGATATTTAgTCATGCGTCTGAGTTTTTTCAAACGTTTGTGTATGTTGGTGAATTATXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan