ESTScan Details for Unigene SGN-U590177

Score 
971
Direction 
Forward
Predicted Peptide Sequence 
MAASTMALSSSTFAGXEGETPPSSSEISGNGRITMRKTAAKPQAXLTGEFPGDYGWDTAGLSADPETFAKKSELEVIHCRWAMLGALGCV
FPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDP
EAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPX
Predicted Coding Sequence 
ATGGCTGCTTCTACAATGGCTCTTTCCTCCTCTACCTTCGCCGGAXTAGAAGGTGAAACTCCACCATCTTCTTCTGAAATCAGTGGAAAT
GGGAGAATTACAATGAGGAAGACTGCTGCCAAGCCCCAAGCTXATTTGACTGGTGAGTTCCCTGGTGATTACGGATGGGACACTGCTGGG
CTTTCAGCTGACCCTGAAACATTCGCTAAGAAATCGGAGTTGGAGGTTATTCATTGCAGATGGGCCATGCTTGGTGCTCTTGGATGTGTT
TTCCCCGAGCTTTTGGCACGTAACGGTGTTAAGTTTGGTGAAGCTGTATGGTTCAAAGCTGGATCTCAAATTTTCAGCGAGGGCGGACTT
GACTACTTGGGAAACCCTAGTTTGGTTCATGCACAAAGCATTTTGGCTATTTGGGCTTGCCAAGTTGTGTTGATGGGAGCCGTTGAGGGT
TACCGTATTGCTGGTGGGCCTCTTGGTGAGGTTGTTGATCCACTTTACCCTGGTGGTAGCTTTGACCCATTGGGCCTTGCTGAAGACCCA
GAGGCTTTTGCTGAGCTCAAGGTGAAGGAGATCAAGAATGGTAGACTTGCTATGTTCTCCATGTTTGGATTCTTTGTTCAAGCTATTGTC
ACCGGAAAGGGTCCGTXX
Edits in Original Sequence 
TTATTAAAATTAAACC(5')ATGGCTGCTTCTACAATGGCTCTTTCCTCCTCTACCTTCGCCGGAXTAGAAGGTGAAACTCgCACCATCT
TCTTCTGAAATCAGTGGAAATGGGAGAATTACAATGAGGAAGACTGCTGCCAAGCCCCAAGCTXATTTGACTGGTGAGTTCCCTGGTGAT
TACGGATGGGACACTGCTGGGCTTTCAGCTGACCCTGAAACATTCGCTAAGAAATCGtGAGTTGGAGGTTATTCATTGCAGATGGGCCAT
GCTTGGTGCTCTTGGATGTGTTTTCCCCGAGCTTTTGGCACGTAACGGTGTTAAGTTTGGTGAAGCTGTATGGTTCAAAGCTGGATCTCA
AATTTTCAGCGAGGGCGGACTTGACTACTTGGGAAACCCTAGTTTGGTTCATGCACAAAGCATTTTGGCTATTTGGGCTTGCCAAGTTGT
GTTGATGGGAGCCGTTGAGGGTTACCGTATTGCTGGTGGGCCTCTTGGTGAGGTTGTTGATCCACTTTACCCTGGTGGTAGCTTTGACCC
ATTGGGCCTTGCTGAAGACCCAGAGGCTTTTGCTGAGCTCAAGGTGAAGGAGATCAAGAATGGTAGACTTGCTATGTTCTCCATGTTTGG
ATTCTTTGTTCAAGCTATTGTCACCGGAAAGGGTCCGTXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan