ESTScan Details for Unigene SGN-U590364

Score 
149
Direction 
Forward
Predicted Peptide Sequence 
VYVFLKEFMATNNHALVTTIGRLKKENLNALN*
Predicted Coding Sequence 
GTTTATGTGTTCCTAAAGGAGTTTATGGCAACAAACAATCATGCCCTTGTTACAACAATTGGAAGACTCAAGAAGGAAAACCTAAATGCC
CTTAATTAA
Edits in Original Sequence 
(5')GTTTATGTGTTCCTAAAGGAGTTTATGGCAACAAACAATCATGCCCTTGTTACAACAATTGGAAGACTCAAGAAGGAAAACCTAAA
TGCCCTTAATTAA(3')TTAAAATATTAATAATTAGGGAAATTAATCTTTTTTTCCCAATAATTAATGGAAAAGATTAAGAGTACTATAG
CTATATGGTCATATTGTGTTTTGTATTGCATTAAATTGATTTGGAGTAATTTTGATGTAATGTTTTAAGCATTTTGTATTTCTCTACTTG
GGGTATCATGGTGTCTGAACTGAGTTGTAATACTGGAGCGATATATGATCTATGGATTAAGAATCATATAACCGGTTTCCACTTGCTCCG
AAAAGAAATGGTATTGGAATCCTTCTTTTTTATAACCAAACTATAATAATAACTTATTTATTGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan