ESTScan Details for Unigene SGN-U590510

Score 
110
Direction 
Forward
Predicted Peptide Sequence 
XCTNLLHLPALTPSRTTVKPAAKETEKMPGIKGPSDYSREPPRHPSLKINAXGKINIKGYALSGGGXWHIKGRRVYDGGKTWEEATRYQR
TGVPYIADDSSSDRWAWVFFEAEADIPHSAE
Predicted Coding Sequence 
XTTTGTACAAATCTTCTTCATCTACCTGCACTCACACCTAGCAGGACTACTGTGAAGCCGGCGGCAAAGGAAACTGAGAAAATGCCTGGG
ATTAAAGGGCCTTCCGATTATTCGCGAGAACCCCCTCGCCATCCTTCTCTTAAAATTAATGCCAXTGGAAAGATAAACATCAAGGGGTAC
GCATTATCAGGAGGTGGGCXGTGGCATATAAAGGGTAGACGTGTCTATGATGGTGGTAAAACTTGGGAGGAAGCCACCAGATACCAGAGA
ACTGGTGTTCCATATATTGCTGATGATTCAAGCAGTGACAGATGGGCATGGGTCTTTTTTGAAGCTGAGGCAGATATTCCCCACAGTGCG
GAA
Edits in Original Sequence 
(5')XTTTGTACAAATCTTCTTCATCTACCTcGCACTCACACCTAGCAGGACTACTGTGAAGCCGGCGGCAAAGGAAACTGAGAAAATGC
CTGGGATTAAAGGGCCTTCCGATTATTCGCGAGAACCCCCTCGCCATCCTTCTCTTAAAATTAATGCCAXTGGAAAGATAAACATCAAGG
GGTACGCATTATCAGGAGGTGGGCXGTGGCATATAAAGGGTAGACGTGTCTATaGATGGTGGTAAAACTTGGGAGGAAGCCACCAGATAC
CAGAGAACTGGTGTTCCATATATTGCTGATGATTCAAGCAGTGACAGATGGGCATGGGTCTTTTTTGAAGCTGAGGCAGATATTCCCCAC
AGTGCGGAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan