ESTScan Details for Unigene SGN-U590554

Score 
548
Direction 
Forward
Predicted Peptide Sequence 
AGFSLNRSLILKALFRDHHQGSVMGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWD
VGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLXQRPGRHFA
SACENDLLTFEEFLSWFFSVSGTSRALXATSGEGLYEGLDWLSNNIANRL
Predicted Coding Sequence 
GCAGGTTTCTCTCTCAATAGATCCCTCATTCTAAAAGCTCTTTTCAGGGATCATCATCAAGGAAGCGTGATGGGGCTCACATTCACCAAG
CTCTTCAGTCGGCTTTTCGCCAAGAAGGAAATGCGCATTCTAATGGTTGGTCTTGATGCAGCTGGTAAGACCACCATATTGTACAAGTTG
AAGCTGGGAGAGATCGTGACTACTATTCCTACCATTGGTTTCAATGTGGAGACTGTTGAGTACAAGAACATCAGCTTCACTGTTTGGGAT
GTCGGAGGTCAGGACAAGATCCGTCCATTGTGGAGGCACTACTTCCAGAACACTCAGGGTCTCATTTTTGTGGTTGATAGCAATGATAGA
GACCGTGTTGTAGAAGCAAGAGATGAATTGCATAGGATGTTGAACGAGGATGAACTTCGGGATGCTGTGCTTCTAGTATTTGCTAACAAA
CAAGATCTTCCTAACGCAATGAATGCTGCTGAAATAACTGATAAGCTTGGACTGCACTCCCTCAGNCAGCGTCCTGGTAGGCACTTTGCT
AGTGCTTGTGAGAATGATTTGCTTACTTTTGAGGAGTTTCTAAGTTGGTTTTTTTCTGTATCAGGTACATCCAGAGCACTTGXTGCAACT
TCTGGCGAGGGGCTTTATGAGGGACTTGATTGGCTTTCTAACAACATTGCTAACAGGCTX
Edits in Original Sequence 
(5')GCAGGTTTCTCTCTCAATAGATCCCTCATTCTAAAAGCTCTTTTCAGGGATCATCATCAAGGAAGCGTGATGGGGCTCACATTCAC
CAAGCTCTTCAGTCGGCTTTTCGCCAAGAAGGAAATGCGCATTCTAATGGTTGGTCTTGATGCAGCTGGTAAGACCACCATATTGTACAA
GTTGAAGCTGGGAGAGATCGTGACTACTATTCCTACCATTGGTTTCAATGTGGAGACTGTTGAGTACAAGAACATCAGCTTCACTGTTTG
GGATGTCGGAGGTCAGGACAAGATCCGTCCATTGTGGAGGCACTACTTCCAGAACACTCAGGGTCTCATTTTTGTGGTTGATAGCAATGA
TAGAGACCGTGTTGTAGAAGCAAGAGATGAATTGCATAGGATGTTGAACGAGGATGAACTTCGGGATGCTGTGCTTCTAGTATTTGCTAA
CAAACAAGATCTTCCTAACGCAATGAATGCTGCTGAAATAACTGATAAGCTTGGACTGCACTCCCTCAGNCAGCGTCaCTGGTAGGCACT
TTGCTAGTGCTTGTGAGAATGATTTGCTTACTTTTGAGGAGTTTCTAAGTTGGTTTTTTTCTGTATCAGGTACATCCAGAGCACTTGXTG
CAACTTCTGGCGAGGGGCTTTATGAGGGACTTGATTGGCTTTCTAACAACATTGCTAACAGGCTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan