ESTScan Details for Unigene SGN-U590648

Score 
303
Direction 
Forward
Predicted Peptide Sequence 
APSPSGTKAVTPPPTEEVVREGEDGENEQVQNEELPPQPTQEMINQVLAYLSGLSDQGQAPPVFSALAPQAPEVQHAPTVTPRIDTSLEI
GTFPRLTTGPIMTNDQHELFSKFLKLKPQVYKGVESEDAYDFLVDCHELLHKMGIVERFGVEFVTYQFQGNAKMWWRSHVECQPTEAPRM
TWASFX
Predicted Coding Sequence 
GCACCTAGCCCATCTGGTACTAAGGCGGTGACACCTCCACCAACTGAGGAAGTGGTAAGAGAGGGTGAGGATGGGGAGAATGAACAAGTG
CAGAATGAGGAATTGCCACCCCAACCTACCCAAGAGATGATCAATCAGGTTCTTGCTTACCTTAGCGGGTTATCTGATCAAGGCCAAGCA
CCTCCAGTGTTTTCTGCACTAGCACCTCAGGCTCCGGAGGTACAACATGCGCCTACTGTGACTCCCCGCATCGATACCTCATTGGAAATA
GGAACGTTTCCCCGTCTGACTACAGGGCCTATAATGACAAATGATCAGCATGAACTTTTTAGTAAGTTCTTGAAATTGAAACCTCAAGTC
TACAAGGGTGTTGAATCTGAGGATGCCTACGATTTTCTGGTTGACTGTCATGAGCTACTACACAAGATGGGTATAGTAGAACGGTTTGGT
GTTGAGTTTGTGACTTATCAGTTTCAAGGGAACGCCAAAATGTGGTGGCGGTCACATGTTGAGTGTCAACCAACAGAGGCACCACGTATG
ACTTGGGCATCATTCTXX
Edits in Original Sequence 
(5')GCACCTAGCCCATCTGGTACTAAGGCGGTGACACCTCCACCAACTGAGGAAGTGGTAAGAGAGGGTGAGGATGGGGAGAATGAACA
AGTGCAGAATGAGGAATTGCCACCCCAACCTACCCAAGAGATGATCAATCAGGTTCTTGCTTACCTTAGCGGGTTATCTGATCAAGGCCA
AGCACCTCCAGTGTTTTCTGCACTAGCACCTCAGGCTCCGGAGGTACAACATGCGCCTACTGTGACTCCCCGCATCGATACCTCATTGGA
AATAGGAACGTTTCCCCGTCTGACTACAGGGCCTATAATGACAAATGATCAGCATGAACTTTTTAGTAAGTTCTTGAAATTGAAACCTCA
AGTCTACAAGGGTGTTGAATCTGAGGATGCCTACGATTTTCTGGTTGACTGTCATGAGCTACTACACAAGATGGGTATAGTAGAACGGTT
TGGTGTTGAGTTTGTGACTTATCAGTTTCAAGGGAACGCCAAAATGTGGTGGCGGTCACATGTTGAGTGTCAACCAACAGAGGCACCACG
TATGACTTGGGCATCATTCTXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan