ESTScan Details for Unigene SGN-U590686

Score 
53
Direction 
Reverse
Predicted Peptide Sequence 
ERFSKEGEGGYDXEQELKMNNIVILLAPPSSDTPWELWGQNLADRFKIDVPSIMYCNSFYECHVDYLIPCFLLFSPSSPSLTSSSVGGGV
TALASDGLGARPLPLEDVLSRPLPRPLAAVL
Predicted Coding Sequence 
GAGCGGTTTTCCAAGGAAGGGGAGGGCGGATATGATGXTGAGCAAGAGCTGAAAATGAATAACATTGTCATACTTTTAGCTCCTCCAAGC
TCGGACACTCCTTGGGAACTCTGGGGTCAGAATTTGGCCGATAGGTTTAAGATTGATGTACCATCTATTATGTACTGTAATAGTTTCTAT
GAATGCCATGTAGACTATTTAATACCCTGTTTCTTGTTGTTCTCCCCATCCTCCCCCTCTCTTACTAGCTCCTCAGTCGGTGGAGGAGTC
ACCGCCCTAGCATCAGATGGACTAGGTGCTCGTCCTCTTCCTCTAGAGGACGTTCTCTCACGACCTCTACCACGGCCTCTTGCCGCTGTT
CTC
Edits in Original Sequence 
(5')GAGCGGTTTTCCAAGGAAGGGGAGGGCGGATATGATGXTGAGCAAGAGCTGAAAATGAATAACATTaGTCATACTTTTAGCTCCTC
CAAGCTCGGACACTCCTTGGGAACTCTGGGGTCAGAATTTGGCCGATAGGTTTAAGATTGATGTACCATCTATTATGTACTGTAATAGTT
TCTATGAATGCCATGTAGACTATTTAATACCCTGTTTCTTGTTGTTCTCCCCATCCTCCCCCTCTCTTACTAGCTCCTCAGTCGGTGGAG
GAGTCACCGCCCTAGCATCAGATGGACTAGGTGCTCGTCCTCTTCCTCTAGAGGACGTTCTCTCACGACCTCTACCACGGCCTCTTGCCG
CTGTTCTC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan