ESTScan Details for Unigene SGN-U590834

Score 
230
Direction 
Reverse
Predicted Peptide Sequence 
MSENQNFKAKQSKGENNFSGSSSHLLLRGVWSPLLTKANNSSDESAIXIAYACVHVLWASSSYPASQPWVFAL*
Predicted Coding Sequence 
ATGTCTGAGAATCAAAATTTCAAAGCAAAGCAAAGCAAAGGTGAAAACAACTTCTCTGGCTCAAGTTCTCATCTACTTCTCAGAGGAGTT
TGGTCCCCTCTTCTTACCAAAGCCAACAACAGCAGTGACGAATCTGCGATTGXTATTGCATACGCTTGTGTGCACGTCCTCTGGGCTTCT
TCTTCTTATCCTGCTTCGCAACCTTGGGTGTTTGCCCTCTAA
Edits in Original Sequence 
GTTATGCAAATTCCAAACTTGAGTTAAACCACCCAGTATGAACAACTGTTTTCAGAAAACAGCTTCATCATGTTTATAAATTCAATAGCA
AAAGCAACTAATCAAGAAAGTCAAAACAAATGATATAAAGTATAAAAAAGGACAGGATGAAATTCAATTAATTCTGGCAAAACAAAAGTA
CTCATCCAACCTACAAATACCAATAGTAGCTAGTCTNTCTCCCATTATG
(5')ATGTCTGAGAATCAAAATTTaCAAAGCAAAGCAAAGC
AAAGGTGAAAACAACTTCTCTGGCTCAAGTTCTCATCTACTTCTCAGAGGAGTTTGGTCCCCTCTTCTTACCAAAGCCAACAACAGCAGT
GACGAATCTGCGATTGXTATTGCATACGCTTGTGTGCACGTCCTCTGGGCTTCTTCTTCTTATCCTGCTTCGCAACCTTGGGTGTTTGCC
CTCTAA(3')CCTTACCAGCACGAGCAAGTGATCCGTTGAACCTTACCCATTGTTATTTCTGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan