ESTScan Details for Unigene SGN-U590886

Score 
536
Direction 
Forward
Predicted Peptide Sequence 
KAVGKVLPQPNGKLTGMAFRVPTADVSVVDLTVRLEKEASYEDIKAAIKEESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALS
KNFVKVVSWYDNEWGYSSRVIDLICHMAKALIDAAGEQKTAM
Predicted Coding Sequence 
AAGGCTGTTGGAAAAGTGCTCCCACAACCTAACGGCAAATTGACTGGAATGGCCTTCAGAGTACCAACTGCTGATGTCTCCGTTGTCGAT
CTTACTGTAAGACTCGAGAAAGAAGCCTCCTATGAAGACATTAAGGCTGCAATCAAGGAGGAATCAGAGGGTAAATTGAAGGGTATCTTG
GGATACACTGAAGATGATGTGGTTTCCACAGACTTTGTTGGTGACAGCAGGTCAAGCATTTTTGATGCCAAGGCTGGAATTGCTTTGAGC
AAGAATTTTGTGAAAGTTGTGTCATGGTATGACAACGAATGGGGTTACAGTTCCCGTGTGATTGATTTGATCTGCCATATGGCTAAGGCX
TTGATTGATGCTGCTGGGGAGCAAAAGACAGCAATG
Edits in Original Sequence 
(5')AAGGCTGTTGGAAAAGTGCTCCCACAACCTAACGGCAAATTGACTGGAATGGCCTTCAGAGTACCAACTGCTGATGTCTCCGTTGT
CGATCTTACTGTAAGACTCGAGAAAGAAGCCTCCTATGAAGACATTAAGGCTGCAATCAAGGAGGAATCAGAGGGTAAATTGAAGGGTAT
CTTGGGATACACTGAAGATGATGTGGTTTCCACAGACTTTGTTGGTGACAGCAGGTCAAGCATTTTTGATGCCAAGGCTGGAATTGCTTT
GAGCAAGAATTTTGTGAAAGTTGTGTCATGGTATGACAACGAATGGGGTTACAGTTCCCGTGTGATTGATTTGATCTGCCATATGGCTAA
GGCXTTGATTGATGCTGCTGGGGAGCAAAAGACAGCAATG(3')TGTTTTAGTTTTTGCTTGGAAGTACTATTAGTTTTGTGGGCCTGGA
GTGGTCTTTCTTGTTTATGTGTAATTGAATAACCAGAGAAGAACGGAACCCTGTTGTTATCTTTGAGGAAATCTTTTTTATTGTTTGACT
TTGTCATGAATGAAACAATCAAACTTTACTTTTCTCTTGCAAAAAACAGAGGAAAAATATTCCAGAGAAAGATTCCTTGGGGGGGGGCGC
GGGACCCTTTTCCCCCATA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan