ESTScan Details for Unigene SGN-U591049

Score 
333
Direction 
Forward
Predicted Peptide Sequence 
APLVVKPSNVKELAESPDLRCIPYNYVYDSSNSSATNDIDDSDSIPIVDFSLLTSHDSHQRSTAIHHLTKAWQGWXLLPGNEPPDNRKFE
*
Predicted Coding Sequence 
GCTCCACTTGTGGTTAAACCATCCAATGTCAAAGAGCTTGCTGAATCTCCTGATTTGCGTTGCATACCTTACAATTATGTTTATGACTCT
TCCAATTCCTCTGCTACAAATGATATTGATGATTCAGATTCAATCCCCATTGTTGATTTTTCTCTACTCACCTCTCATGATTCTCATCAA
CGTTCTACAGCCATCCACCACCTCACCAAAGCTTGGCAAGGGTGGXGGCTTCTTCCTGGGAATGAACCACCGGATAACAGAAAATTTGAA
TAA
Edits in Original Sequence 
(5')GCTCCACTTGTGGTTAAACCATCCAATGTCAAAGAGCTTGCTGAATCTCCTGATTTGCGTTGCATACCTTACAATTATGTTTATGA
CTCTTCCAATTCCTCTGCTACAAATGATATTGATGATTCAGATTCAATCCCCATTGTTGATTTTTCTCTACTCACCTCTCATGATTCTCA
TCAACGTTCTACAGCCATCCACCACCTCACCAAAGCTTGGCAAGGGTGGXGGCTTCTTCCTGGGAATGAACCACCGGATAACAGAAAATT
TGAATAA(3')ATCAGTGAATGATTGGCCTCCTTAATTTTTTCATTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan