ESTScan Details for Unigene SGN-U591160

Score 
80
Direction 
Reverse
Predicted Peptide Sequence 
XKKNFVFLTEDHSVVNXINQIKTKETLEWPYMVISNYTEKPSHPRAEFGRRX
Predicted Coding Sequence 
XCCAAAAAGAATTTTGTTTTCCTAACTGAGGATCATTCAGTTGTTAATXACATAAATCAAATCAAAACAAAGGAAACACTAGAGTGGCCT
TACATGGTGATCAGCAATTATACAGAAAAACCAAGCCACCCTCGTGCTGAATTCGGCAGGAGGCXX
Edits in Original Sequence 
(5')XCCAAAAAGAATTTTGTTTTCCTAACTGAGGATCATTCAGTTGTTAATXACATAAATCAAATCAAAACAAAGGAAACACTAGAGTG
GCCTTACATGGTGATCAGCAATTATACAGAAAAACCAAGCCACCCTCGTGCTGAATTCGGCAGGAGGCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan