Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

ESTScan Details for Unigene SGN-U591185

Score 
189
Direction 
Forward
Predicted Peptide Sequence 
TAGNGVFAEIIDGEVYKYYCEGEWKKSASGKSVAIINPTTRKIQYKVQACTQEEVNKVMEX
Predicted Coding Sequence 
ACGGCTGGAAATGGAGTATTTGCAGAAATAATTGATGGAGAAGTGTACAAATATTATTGTGAAGGAGAATGGAAAAAATCAGCTTCTGGA
AAATCTGTTGCTATTATTAATCCTACTACAAGAAAGATACAATACAAAGTTCAAGCATGTACACAAGAAGAGGTGAACAAAGTAATGGAA
ATX
Edits in Original Sequence 
GATCCAAAGTAGGAATCCACCATTTTCTCTTCTTAGTCTTTTTTTTTTTAATTATTGTGAAAGGAAGTTTAAAATTTGGTGTAAAA(5')
ACGGCTGGAAATGGAGTATTTGCAGAAATAATTGATGGAGAAGTGTACAAATATTATTGTGAAGGAGAATGGAAAAAATCAGCTTCTGGA
AAATCTGTTGCTATTATTAATCCTACTACAAGAAAGATACAATACAAAGTTCAAGCATGTACACAAGAAGAGGTGAACAAAGTAATGGAA
ATX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan