ESTScan Details for Unigene SGN-U591359

Score 
267
Direction 
Forward
Predicted Peptide Sequence 
XFKAGSQVFSEGGLDYLGNPSLVMHKAFWLFGLAKLVDXEPWGYRLLVGLLGGCDPLYPGEFDPLALLKTQRLLLAKVKEIKNGDLLCLH
GGFFVQAIVPERACENLAXHIADPVNNNAWAF
Predicted Coding Sequence 
XXGTTCAAAGCTGGATCTCAGGTTTTCAGCGAGGGCGGACTTGACTACTTGGGAAACCCTAGTTTGGTCATGCACAAAGCATTTTGGCTA
TTTGGGCTTGCCAAGTTGGTTGATGXGGAGCCGTGGGGTTACCGATTGCTGGTGGGCCTCTTGGGAGGTTGTGATCCACTTTACCCTGGG
GAGTTTGACCCATTGGCCTTGCTGAAGACCCAGAGGCTTTTGCTGGCTAAGGTGAAGGAGATCAAGAATGGAGACTTGCTATGTCTACAT
GGTGGATTCTTTGTTCAAGCTATTGTACCGGAAAGGGCCTGTGAGAACCTTGCTXACCACATTGCTGACCCAGTTAACAACAACGCCTGG
GCTTTT
Edits in Original Sequence 
(5')XXGTTCAAAGCTGGATCTCAGGTTTTCAGCGAGGGCGGACTTGACTACTTGGGAAACCCTAGTTTGGTCATGCACAAAGCATTTTG
GCTATTTGGGCTTGCCAAGTTGGTTGATGXGGAGCCGTGGGGTTACCGATTGCTGGTGGGCCTCTTGGGAGGTTGTGATCCACTTTACCC
TGGGGAGcTTTGACCCATTGGCCTTGCTGAAGACCCAGAGGCTTTTGCTGGCTAAGGTGAAGGAGATCAAGAATGGAGACTTGCTATGTC
TACATGGTGGATTCTTTGTTCAAGCTATTGTACCGGAAAGGGCCTGTGAGAACCTTGCTXACCACATTGCTGACCCAGTTAACAACAACG
CCTGGGCTTTT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan