Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U591487

Score 
9
Direction 
Forward
Predicted Peptide Sequence 
XDLTISKMVSDAAREIDAQNKAAPAAMRGGKGAAAPKSAATASKSAVESNGVDNWTNGVWDLQISDRTCTGRLVFTSAIWDIRIESLSVT
FHGHDLIVDSELELX
Predicted Coding Sequence 
XTAGATCTTACTATTTCAAAGATGGTGTCGGATGCGGCGAGGGAGATAGATGCGCAGAATAAGGCTGCCCCAGCTGCTATGAGAGGAGGT
AAAGGTGCGGCAGCGCCTAAATCGGCTGCAACCGCGTCTAAATCGGCGGTGGAAAGTAACGGGGTTGATAATTGGACGAATGGAGTATGG
GATCTACAGATATCTGATCGGACTTGTACXGGACGTCTTGTGTTCACATCCGCTATCTGGGATATTCGGATAGAGTCATTATCAGTCACT
TTCCACGGACATGATCTCATCGTTGATTCTGAACTGGAGCTCAXX
Edits in Original Sequence 
(5')XTAGATCTTACTATTTCAAAGATGGTGTCGGATGCGGCGAGGGAGATAGATGCGCAGAATAAGGCTGCCCCAGCTGCTATGAGAGG
AGGTAAAGGTGCGGCAGCGCCTAAATCGGCTGCAACCGCGTCTAAATCGGCGGTGGAAAGTAACGGGGTTGATAATTGGACGAATGGAGT
ATGGGATCTACAGATATCTGATCGGACTTGTACXGGACGTCTTGTGTTCACATCCGCTATCTaGGGATATTCGGATAGAGTCATTATCAG
TCACTTTCCACGGACATGATCTCATCGTTGATTCTGAACTGGAGCTCAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan