ESTScan Details for Unigene SGN-U591538

Score 
429
Direction 
Forward
Predicted Peptide Sequence 
MGFIGSAFNIKGQMQCPNCRKIEKGQWLYASGCRPLPDFNMEDWAHDEDLYDLSYTEMSFGVHWCPFSGLTRLPASFDEGELSSSAYHDL
LGQHAIFADHTAVSSAAHPCPYIAYVGIHPSSSNSSGSINDGPNFNITGLVHLVPNEIPASYAFPGMDVHYHSWEHHSSFPMASKSVGTA
DQSSVP
Predicted Coding Sequence 
ATGGGATTCATTGGTTCTGCCTTTAACATCAAGGGGCAAATGCAGTGTCCCAACTGTCGGAAAATTGAGAAGGGTCAATGGCTATATGCA
AGTGGTTGCCGTCCCCTACCAGATTTCAACATGGAAGATTGGGCCCATGATGAAGACCTATATGATCTGAGCTACACTGAAATGTCATTT
GGAGTTCACTGGTGTCCGTTTAGTGGATTGACTCGACTACCAGCATCTTTTGACGAAGGGGAGCTTTCATCTAGTGCATATCATGATCTT
CTTGGTCAGCATGCTATATTTGCTGATCACACAGCTGTATCATCTGCTGCTCATCCATGCCCGTATATTGCCTATGTTGGAATTCACCCA
TCATCCTCAAATTCGAGTGGAAGTATCAATGATGGTCCTAATTTCAACATCACTGGACTAGTCCATCTTGTTCCCAACGAGATACCTGCT
TCTTATGCTTTCCCAGGAATGGATGTGCATTATCATAGTTGGGAACATCATTCTTCTTTCCCTATGGCAAGCAAGTCTGTTGGTACTGCT
GATCAGTCCTCGGTTCCC
Edits in Original Sequence 
GCCCCATCCATCTTCTCGTCTCTTCTCTTCTCTTCTCACCTATCACCAAATCGCTTCCTCAATATTCCGAGACCCTTTTGCTTAGCCTTC
TTAATCGGATTCTCCTCATCTTTTTTTTTCTTACATACCCCCCCTTTTCTTTTTTCATCAACAAAGATCAACGCAAGATTACCGTTTTTC
TTTTTTCTTCTTTTCTTCTTTTTGCTAGGAGTAAACCAAGTTGTTGTAGCTTGTGTTTGACAGTAAATT
(5')ATGGGATTgCATTGGTT
CTGCCTTTAACATCAAGGGGCAAATGCAGTGTCCCAACTGTCGGAAAATTGAGAAGGGTCAATGGCTATATGCAAGTGGTTGCCGTCCCC
TACCAGATTTCAACATGGAAGATTGGGCCCATGATGAAGACCTATATGATCTGAGCTACACTGAAATGTCATTTGGAGTTCACTGGTGTC
CGTTTAGTGGATTGACTCGACTACCAGCATCTTTTGACGAAGGGGAGCTTTCATCTAGTGCATATCATGATCTTCTTGGTCAGCATGCTA
TATTTGCTGATCACACAGCTGTATCATCTGCTGCTCATCCATGCCCGTATATTGCCTATGTTGGAATTCACCCATCATCCTCAAATTCGA
GTGGAAGTATCAATGATGGTCCTAATTTCAACaATCACTGGACTAGTCCATCTTGTTCCCAACGAGATACCTGCTTCTTATGCTTTCCCA
GGAATGGATGTGCATTATCATAGTTGGGAACATCATTCTTCTTTCCCTATGGCAAGCAAGTCgTGTTGGTACTGCTGATCAGTCCTCGGT
TCCC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan