ESTScan Details for Unigene SGN-U592041

Score 
840
Direction 
Forward
Predicted Peptide Sequence 
MTLLSSLPSTTIHFTLFLQNLQSSAKASSMASISAASATAAAAASTKINTSGTVLPSKSSKLILSSSFTPNPSTLFLHSPATTAPSSSSS
RHRRFTVRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTMALASLGNSAPKKYDEIDAAP
Predicted Coding Sequence 
ATGACTTTATTATCCTCTCTTCCTTCTACCACAATTCATTTCACTCTCTTTCTCCAAAATCTTCAATCCTCAGCAAAAGCTTCTTCCATG
GCTTCAATTTCAGCAGCTTCTGCAACTGCTGCTGCTGCTGCTTCTACAAAGATTAATACCAGTGGTACTGTTCTTCCTTCAAAATCCTCT
AAGCTTATCCTTTCATCTTCTTTTACACCAAACCCATCAACCCTTTTCCTCCATTCACCCGCCACTACTGCACCTTCTTCTTCTTCCTCC
CGCCACCGCCGGTTTACTGTCCGAGCTGCGCGTGGTAAATTCGAAAGGAAGAAACCCCATGTCAATATTGGTACAATTGGCCATGTTGAC
CATGGGAAAACCACACTTACAGCTGCTTTGACAATGGCGCTTGCTTCTCTGGGTAACTCCGCCCCGAAGAAGTATGATGAAATTGATGCT
GCCCCT
Edits in Original Sequence 
TGGGCTATTATATTATAGGCTCTCTTTCTCCCTACCAAGAGGAAAG(5')ATGACTTTATTATCCTCTCTTCCTTCTACCACAATTCATT
TCACTCTCTTTCTCCAAAATCTTCAATCCTCAGCAAAAGCTTCTTCCATGGCTTCAATTTCAGCAGCTTCTGCAACTGCTGCTGCTGCTG
CTTCTACAAAGATTAATACCAGTGGTACTGTTCTTCCTTCAAAATCCTCTAAGCTTATCCTTTCATCTTCTTTTACACCAAACCCATCAA
CCCTTTTCCTCCATTCACCCGCCACTACTGCACCTTCTTCTTCTTCCTCCCGCCACCGCCGGTTTACTGTCCGAGCTGCGCGTGGTAAAT
TCGAAAGGAAGAAACCCCATGTCAATATTGGTACAATTGGCCATGTTGACCATGGGAAAACCACACTTACAGCTGCTTTGACAATGGCGC
TTGCTTCTCTGGGTAACTCCGCCCCGAAGAAGTATGATGAAATTGATGCTGCCCCT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan