ESTScan Details for Unigene SGN-U592271

Score 
35
Direction 
Forward
Predicted Peptide Sequence 
QNTALMFHNMESVTSVMECEILAKKRLPKMIYDYYASGAEDQWTLQENRNAFSKILKYFYKGSGPXILVDVSNIDTTTSVLGYKISMPIM
VAPTAMQKMAHPEGECATARATSAAGTIMVWISKPPSVPRGYSPKFHYLHTYPCYKLKFVGYFRHYPHGVLPXVEEVASTGPGIRFFQLY
V
Predicted Coding Sequence 
CAGAATACAGCACTAATGTTTCATAATATGGAGAGTGTTACCAGTGTCATGGAGTGTGAAATCCTAGCAAAAAAGAGGTTACCCAAAATG
ATATACGATTATTATGCCTCTGGTGCAGAGGACCAGTGGACACTCCAAGAGAATCGAAATGCGTTCTCTAAGATTTTGAAGTACTTCTAT
AAAGGTTCAGGCCCCGXTATTCTTGTAGACGTTAGCAATATTGATACAACCACCAGTGTCTTGGGATATAAGATATCAATGCCCATCATG
GTTGCTCCGACTGCAATGCAGAAAATGGCTCATCCTGAAGGAGAATGTGCAACAGCGCGAGCAACATCTGCTGCTGGTACCATCATGGTT
TGGATTTCTAAGCCCCCTTCTGTGCCTAGAGGCTATAGCCCTAAATTTCATTATTTACATACATATCCCTGCTACAAATTGAAATTTGTT
GGTTATTTTAGACATTATCCTCATGGGGTACTTCCAGXTGTAGAAGAGGTTGCTTCAACAGGACCAGGCATTCGCTTTTTCCAGCTCTAT
GTG
Edits in Original Sequence 
(5')CAGAATACAGCACTAATGTTTCATAATATGGAGAGTGTTACCAGTGTCATGGAGTGTGAAATCCTAGCAAAAAAGAGGTTACCCAA
AATGATATACGATTATTATGCCTCTGGTGCAGAGGACCAGTGGACACTCCAAGAGAATCGAAATGCGTTCTCTAAGATTTTGtAAGTACT
TCTATAAAGGTTCAGGCCCCGXTATTCTTGTAGACGTTAGCAATATTGATACAACCACCAGTGTCTTGGGATATAAGATATCAATGCCCA
TCATGGTTGCTCCGACTGCAATGCAGAAAATGGCTCATCCTGAAGGAGAATGTGCAACAGCGCGAGCAACATCTGCTGCTGGTACCATCA
TGGTTTGGATTTCTAtAGCCCCCTTCTGTGCCTAGAGGCTATAGCCCTAAATTTCATTATTTACATACATATCCCTGCTACAAATTGAAA
TTTaGTTGGTTATTTTAGACATTATCCTCATGGGGTACTTCCAGXTGTAGAAGAGGTTGCTTCAACAGGACCAGGCATTCGCTTTTTCCA
GCTCTATGTG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan