ESTScan Details for Unigene SGN-U592287

Score 
136
Direction 
Forward
Predicted Peptide Sequence 
QEGKEKKGFLDKIKEKLPRYGSTAEEEKEKEKD*
Predicted Coding Sequence 
CAGGAGGGGAAGGAGAAGAAGGGATTTTTGGACAAAATTAAGGAGAAATTACCACGATACGGGTCAACGGCTGAAGAGGAAAAGGAGAAG
GAAAAAGACTAA
Edits in Original Sequence 
(5')CAGGAGGGGAAGGAGAAGAAGGGATTTTTGGACAAAATTAAGGAGAAATTACCACGATACGGGTCAACGGCTGAAGAGGAAAAGGA
GAAGGAAAAAGACTAA(3')ATGAAATGAAATGTTTTTTTAATACTACTTTTGGGATGAAATGATTGTGTTTCTGCGTTGTTTTGGTTTT
TAAGTGTATTTCATTTCCTTCACTTTGGTTTTTTTTGGATTGTGAAGGATAATTGGTACTACCTGAATTTGATATTTCTGTATGGGAGAG
CGTATGTATGTGCCTTAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan