ESTScan Details for Unigene SGN-U592652

Score 
570
Direction 
Forward
Predicted Peptide Sequence 
MADLLSNWSSTLEAVPKSHCIPEHERPSDPVEIGDSIPVIDLGKANGEERSVVVKDLLKAFEEYGFFQIINHGVPVDLMDEAMKVYKEFF
SLPAEEKENYAKDAANNTNRX
Predicted Coding Sequence 
ATGGCGGATCTTCTCTCGAACTGGTCAAGCACATTAGAAGCAGTTCCTAAAAGTCATTGCATCCCAGAGCATGAAAGACCATCAGATCCA
GTTGAAATTGGCGACAGTATTCCAGTCATTGATTTGGGAAAAGCTAATGGTGAAGAACGAAGTGTTGTTGTTAAAGATCTGTTGAAAGCT
TTTGAAGAATATGGGTTTTTTCAGATAATCAATCATGGAGTACCTGTAGATCTAATGGATGAAGCNATGAAAGTGTACAAAGAATTTTTC
AGTCTTCCAGCTGAAGAAAAAGAAAATTATGCAAAAGATGCAGCTAATAATACCAATAGGGXX
Edits in Original Sequence 
ATTCATGAAGTAAGTAGAATACAAACTAGAAAGACATTTTGAATTAAAGCTCTTATTTCAGTGGAAATTAAAAGAAGTAGTAGTATTAAC
ATTTAGAAGATAACTTTGTTTCCCAGATTGATTGTCA
(5')ATGGCGGATCTTCTCTCGAACTGGTCAAGCACATTAGAAGCAGTTCCTA
AAAGTCATTGCATCCCAGAGCATGAAAGACCATCAGATCCAGTTGAAATTGGCGACAGTATTCCAGTCATTGATTTGGGAAAAGCTAATG
GTGAAGAACGAAGTGTTGTTGTTAAAGATCTGTTGAAAGCTTTTGAAGAATATGGGTTTTTTCAGATAATCAATCATGGAGTACCTGTAG
ATCTAATGGATGAAGCNATGAAAGTGTACAAAGAATTTTTCAGTCTTCCAGCTGAAGAAAAAGAAAATTATGCAAAAGATGCAGCTAATA
ATACCAATAGGGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan