ESTScan Details for Unigene SGN-U592926

Score 
270
Direction 
Forward
Predicted Peptide Sequence 
XSFPGITLIAFAAITYLLSFALKFVAFRNLIYSAGPNRCVYREIEGFSALYGNLSEKKSLDLTGFTWYDYHALLVNPNSLSASSSNLINE
DEKDNXKANENFLGSAFTPRASTEKCPFFVEVXNLSFPLLPVADFVEKHLFRKLHDLLDLGSV
Predicted Coding Sequence 
XXGTCGTTTCCAGGTATCACTCTCATCGCATTTGCAGCAATTACATATCTTCTCTCTTTTGCTCTCAAATTTGTTGCATTTAGGAATTTA
ATTTACTCCGCTGGCCCGAATCGATGTGTATACCGTGAAATTGAGGGATTTTCAGCATTGTATGGCAATCTCAGCGAAAAGAAGTCTTTG
GATCTCACTGGCTTCACATGGTATGACTATCACGCCTTGCTGGTAAATCCAAATTCTCTTTCTGCTTCTTCTAGTAACTTGATAAATGAG
GATGAGAAAGATAATXCTAAAGCCAATGAGAATTTCCTTGGCTCTGCATTCACCCCTAGAGCGAGCACCGAAAAGTGCCCTTTCTTTGTT
GAAGTTGXTAACTTGAGCTTTCCACTTCTTCCAGTTGCTGATTTTGTGGAGAAACATCTTTTTAGAAAGCTTCATGATCTTCTTGACCTC
GGGTCTGTT
Edits in Original Sequence 
(5')XXGTCGTTTCCAGGTATCACTCTCATCGCATTTGCAGCAATTACATATCTTCTCTCTTTTGCTCTCAAATTTGTTGCATTTAGGAA
TTTAATTTACTCCGCTGGCCCGAATCGATGTGTATACCGTGAAATTGAGGGATTTTCAGCATTGTATGGCAATCTCAGCGtAAAAGAAGT
CTTTGGATCTCACTGGCTTCACATGGTATGACTATCACGCCTTGCTGGTAAtATCCAAATTCTCTTTCTGCTTCTTCTAGTAACTTGATA
AATGtAGGATGAGAAAGATAATXCTAAAGCCAATGAGAATTTCCTTGGCTCTGCATTCACCCCTAGAGCGAGCACCGAAAAGTGCCCTTT
CTTTGTTGAAGTTGXTAACTTGAGCTTTCCACTTCTTCCAGTTGCTGATTTTGTGGAGAAACATCTTTTTAGAAAGCTTCATGATCTTCT
TGACCTCGGGTCTGTT(3')TTAAAAGTTAGCTTATTTTTTTTAGTTCTGCGTGGTAATTTCAATTACCTTATTCGACTTGACTTTAAGT
TTTCCTTATTATATATGGTCAAAATTCGATAAATGTAAAACTAAAAATCTTATCTCAATTGTTGAGATATACGTGGTAACCTTATCCGAT
TTGCTCAATCGAAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan