ESTScan Details for Unigene SGN-U592984

Score 
81
Direction 
Reverse
Predicted Peptide Sequence 
XYSDEDIALVDAEQLLIFEHMKKSGFASIVKT*
Predicted Coding Sequence 
XACTATTCAGATGAGGATATTGCGTTGGTTGATGCTGAACAGCTTCTCATCTTTGAGCATATGAAGAAGAGTGGTTTTGCCAGCATTGTC
AAGACCTAA
Edits in Original Sequence 
(5')XACTATTCAGATGtAGGATATTGCGTTGGTTGATGCTGAACtAGCTTCTCATCTTTGAGCATATGAAGAAGAGTGGTTTTGCCAGC
ATTGTCAAGACCTAA(3')GAATAAGATCTTAGGTTCCTTTTGCCACAAACGTAGAGATGGCAGAGGTCCATATAACCAATGCCTCAGAA
ACATTTTTTTTCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan