ESTScan Details for Unigene SGN-U593467

Score 
306
Direction 
Forward
Predicted Peptide Sequence 
XLEVIGLLKSHKASTTISIYXNMMTFINKLQRMEILLQTFLQILQKLAIVELIHLGYGNLQVQNYACVGIGEXLLLELTKLGYGESGLAI
PVRAYGVTYGFEALPNYIAPQGAMLLPWTLRAALLPVPGTRKNLSEPGETNESIPEVDAAS
Predicted Coding Sequence 
XGCTTAGAAGTGATTGGATTGCTTAAGTCACACAAAGCTTCTACAACCATATCTATCTACATXAACATGATGACATTCATCAATAAATTA
CAAAGAATGGAAATATTGTTACAAACTTTCCTTCAAATTTTACAAAAATTGGCAATTGTGGAGTTGATACACCTTGGATATGGAAATCTG
CAAGTCCAAAATTATGCTTGTGTAGGCATTGGCGAAGXTCTGTTGCTTGAGCTCACGAAATTGGGATATGGAGAAAGTGGCCTTGCCATT
CCAGTTCGAGCTTATGGTGTTACTTATGGTTTTGAAGCTCTACCCAATTATATTGCTCCACAAGGAGCTATGCTTTTACCTTGGACACTG
AGGGCTGCTCTTCTTCCTGTTCCAGGGACTAGAAAAAATCTGTCTGAACCTGGGGAGACAAATGAATCAATTCCCGAGGTGGATGCTGCA
TCX
Edits in Original Sequence 
(5')XGCTTAGAAGTGATTGGATTGCTTAAGTCACACAAAGCTTCTACAACCATATCTATCTACATXAACATGATGACATTCATCAATAA
ATTACAAAGAATGGAAATATTGTTACAAACTTTCCTTCAAATTTTACAAAAATTGGCAATTGTGGAGTTGATACACCTTGGATATGGAAA
TCTGCAAGTCCAAAATTATGCTTGTGTAGGCATTGGCGAAGXTCTGTTGCTTGAGCTCACGAtAATTGGGATATGGAGAAAGTGGCCTTG
CCATTCCAGTTCGAGCTTATGGTGTTACTTATGGTTTTGAAGCTCTACCCAATTATATTGCTCCACAAGGAGCTATGCTTTTACCTTGGA
CACTGAGGGCTgGCTCTTCTTCCTGTTCCAGGGACTAGAAAAAATCTGTCTGAACCTGGGGAGACAAATGAATCAATTCCCGAGGTGGAT
GCTGCATCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan