ESTScan Details for Unigene SGN-U593623

Score 
179
Direction 
Reverse
Predicted Peptide Sequence 
XILCKMLQVRDQMYDEKANTITILVFVAVXNGFATNCGKGGKAIKSIEIKEPLKLKAPEKPKEPEKPKEKPEKPKEPEKKPHGYPTNNDD
ASGPRIPPGNAKLWLWAMPLYRWPVLSILWNTRPPQPAPYYGNYSYGYGPGPGPSSYGKGYYGNNDYYNEEDGQGCTIM*
Predicted Coding Sequence 
XXAATTCTCTGCAAAATGCTTCAGGTTCGAGATCAAATGTATGATGAGAAGGCCAACACTATCACCATCCTTGTGTTTGTTGCAGTCNTG
AACGGATTCGCGACAAATTGTGGTAAAGGAGGAAAAGCAATCAAGAGCATTGAGATCAAAGAGCCCTTAAAGCTCAAAGCTCCTGAAAAG
CCCAAGGAGCCCGAAAAGCCCAAGGAAAAGCCCGAAAAGCCCAAAGAACCAGAGAAGAAACCCCATGGATATCCAACCAATAATGATGAT
GCCTCCGGTCCACGGATACCCCCAGGTAATGCCAAGTTGTGGCTGTGGGCAATGCCATTATACCGGTGGCCCGTGTTATCAATATTATGG
AACACCCGTCCCCCACAACCCGCCCCATACTACGGTAACTACTCGTATGGATATGGGCCCGGCCCGGGCCCATCTAGCTATGGAAAGGGT
TATTACGGAAACAATGATTACTATAATGAAGAAGATGGTCAAGGATGCACAATTATGTAA
Edits in Original Sequence 
(5')XXAATTCTCTGCAAAATGCTTCAGGTTCGAGATCAAATGTATGATGAGAAGGCCAACACTATCACCATCCTTGTaGTTTGTTGCAG
TCNTGAACGGATTCGCGACAAATTGTGtGTAAAGGAGGAAAAGCAATCAAGAGCATTGAGATCAAAGAGCCCTTAAAGCTCAAAGCTCCT
GAAAAGCCCAAGGAGCCCGAAAAGCCCAAGGAAAAGCCCGAAAAGCCCAAAGAACCAGAGAAGAAACCCCATGGATATCCgAACCAATAA
TGATGATGCCTCCGGTCCACGGATACCCCCAGGTAATGCCAAGTTGTGGCTGTGGGCAATGCCATTATACCGGTGGCCCGTGTTATCAAT
ATTATGGAACACCCGTaCCCCCACAACCCGCCCCATACTACGGTAACTACTCGTATGGATATGGGCCCGGCCCGGGCCCATCTAGCTATG
GAAAGGGTTATTACGGAAACAATGATTACTATAATGAAGAAGATGGTCAAGGATGCACAATTATGTAA(3')TTGTGGCCCTACTTAGTA
CTTCATTATTGGGCTTTCAAAAGAGCCCAGAACAAAGTTTTGGGCTCCATATGGATGTCTATTTTCTATATTATTACTGTGTTCATTAAT
A

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan