ESTScan Details for Unigene SGN-U594427

Score 
756
Direction 
Forward
Predicted Peptide Sequence 
MEVATDEQHTPIKQDTKKGKLRYYPYNIHWNYGLLPQTWEDPTFANTEVEGAFGDNDPVDVVEIGESRGKIGQVLKVKPLAALAMIDEGE
LDWKIVAISLDDPRASLVNDVDDVEKHFPGTLTAIRDWFRDYKIPDGKPANRFALGNKPANKDYALKIITETNESWAKLVKRSIAAGELS
LXINAD*
Predicted Coding Sequence 
ATGGAAGTTGCTACAGATGAGCAACACACTCCTATTAAACAAGACACAAAGAAGGGGAAACTTCGATACTATCCATATAATATTCACTGG
AACTATGGATTGCTTCCGCAAACATGGGAAGATCCTACTTTTGCGAATACCGAAGTTGAAGGGGCATTTGGTGATAATGACCCTGTTGAT
GTTGTTGAGATTGGGGAAAGCCGAGGTAAAATTGGCCAGGTTCTGAAGGTCAAACCTTTAGCTGCTCTGGCAATGATTGATGAAGGAGAA
CTTGACTGGAAAATAGTTGCTATTTCACTAGACGATCCAAGAGCTTCACTTGTTAATGATGTTGATGATGTGGAAAAACATTTTCCGGGC
ACTCTCACAGCAATCAGGGACTGGTTTAGAGACTATAAGATACCTGATGGAAAACCTGCTAATAGGTTTGCTCTTGGCAACAAGCCAGCA
AACAAGGATTACGCTCTTAAGATTATTACGGAAACCAATGAATCTTGGGCAAAGCTGGTCAAGAGATCAATCGCTGCTGGTGAGCTTTCA
CTTGXTATAAATGCTGATTAA
Edits in Original Sequence 
TAAGAATCAAGTGCAAAG(5')ATGGAAGTTGCTACAGATGAGCAACACACTCCTATTAAACAAGACACAAAGAAGGGGAAACTTCGATA
CTATCCATATAATATTCACTGGAACTATGGATTGCTTCCGCAAACATGGGAAGATCCTACTTTTGCGAATACCGAAGTTGAAGGGGCATT
TGGTGATAATGACCCTGTTGATGTTGTTGAGATTGGGGAAAGCCGAGGTAAAATTGGCCAGGTTCTGAAGGTCAAACCTTTAGCTGCTCT
GGCAATGATTGATGAAGGAGAACTTGACTGGAAAATAGTTGCTATTTCACTAGACGATCCAAGAGCTTCACTTGTTAATGATGTTGATGA
TGTGGAAAAACATTTTCCGGGCACTCTCACAGCAATCAGGGACTGGTTTAGAGACTATAAGATACCTGATGGAAAACCTGCTAATAGGTT
TGCTCTTGGCAACAAGCCAGCAAACAAGGATTACGCTCTTAAGATTATTACGGAAACCAATGAATCTTGGGCAAAGCTGGTCAAGAGATC
AATCGCTGCTGGTGAGCTTTCACTTGXTATAAATGCTGATTAA(3')TAGAGAGCTTAAGCTGGCTAGTTCTCCTGCCTGTAACCTAAAC
TGGACATGGAAATTGTCCCCATGATTGTACTCTTTCGTCTGGGGTGGAAGCCAATTCATATTTTTAAGATGACTTCTTGTTATAAGCTAC
TGTTTTTCCTTTATCATCAATAATTTTGTTCATCCAGTAGCGTCTGTAAGTTATCCAGAACGAAACAGGTGTATTGAACTATTGATATAT
GATTTGATCTTCATTCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan