ESTScan Details for Unigene SGN-U595056

Score 
576
Direction 
Forward
Predicted Peptide Sequence 
METKFPHAVWAAGRSLIALLLPNFDVVDNLWLEPFSWEGIGCTKITKAKNDSISGNVESRSYLEKRLVFCFGSYVAAQLLLPFGEENILS
SSELKQAEEIATRMVIQYGWGPDDSPTIYHHGNSVTTLSMGNHFEYEMAAKVEKIHIDPNLFGIEAXVVVGGHFVFNLGPMFYFLQQSDS
CKTLDSHEAQEPSKMA*
Predicted Coding Sequence 
ATGGAAACAAAATTTCCACATGCTGTTTGGGCTGCAGGTCGGAGTTTAATTGCTCTTCTTTTACCGAACTTTGATGTTGTGGATAATCTG
TGGCTTGAGCCTTTCTCTTGGGAGGGAATTGGGTGTACAAAGATCACCAAAGCTAAAAATGATTCTATCAGCGGGAATGTTGAATCAAGA
TCATACCTGGAGAAGAGACTAGTTTTTTGCTTTGGTTCTTATGTTGCAGCCCAGCTATTGCTTCCATTTGGGGAAGAAAACATTCTTTCT
TCTTCAGAGCTGAAGCAGGCTGAAGAGATAGCTACAAGGATGGTGATTCAGTATGGTTGGGGCCCTGATGATAGTCCTACAATTTACCAT
CATGGCAATTCGGTCACGACTTTGAGTATGGGAAACCATTTTGAATATGAGATGGCTGCAAAAGTGGAAAAGATTCATATTGATCCTAAC
TTGTTTGGGATCGAGGCTXTAGTTGTTGTTGGCGGTCATTTTGTTTTCAATCTAGGGCCAATGTTTTATTTCCTCCAACAAAGTGATAGT
TGTAAAACATTGGATAGCCACGAAGCTCAAGAACCATCTAAAATGGCGTAG
Edits in Original Sequence 
GTTTTGTAGTGGACA(5')ATGGAAACAAAATTTCCACATGCTGTTTGGGCTGCAGGTCGGAGTTTAATTGCTCTTCTTTTACCGAACTT
TGATGTTGTGGATAATCTGTGGCTTGAGCCTTTCTCTTGGGAGGGAATTGGGTGTACAAAGATCACCAAAGCTAAAAATGATTCTATCAG
CGGGAATGTTGAATCAAGATCATACCTGGAGAAGAGACTAGTTTTTTGCTTTGGTTCTTATGTTGCAGCCCAGCTATTGCTTCCATTTGG
GGAAGAAAACATTCTTTCTTCTTCAGAGCTGAAGCAGGCTGAAGAGATAGCTACAAGGATGGTGATTCAGTATGGTTGGGGCCCTGATGA
TAGTCCTACAATTTACCATCATGGCAATTCGGTCACGACTTTGAGTATGGGAAACCATTTTGAATATGAGATGGCTGCAAAAGTGGAAAA
GATTCATATTcGATCCTAACTTGTTTGGGATCGAGGCTXTAGTTGTTGTTGGCGGTCATTTTGTTTTCAATCTAGGGCCAATGTTTTATT
TCCTCCAACAAAGTGATAGTTGTAAAACATTGGATAGCCACGAAGCTCAAGAACCATCTAAAATGGCGTAG(3')AATCTTAGTTGACGG
TAATGGTCGGAAAGTTCCCAATGAGGTTATCATTGAAAGAGTTGTTCTATATTTCATACCAATATGGGTAGAGAGAAAAAACAGGGTTTG
AAATGGTATCGACGACAACCAGAGAAGTCGCTAGAGTTCCTACAGACCGTTTTTTCATCATCTCTTAATATCCACCCGACACAATCAAAC
TCTGCTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan