ESTScan Details for Unigene SGN-U595534

Score 
337
Direction 
Reverse
Predicted Peptide Sequence 
RALIDSXVRPFVLSQIFSEAHAEIMQGRQQHIVAHRINGMAYPDTAKGQKYYTQPTDERNMSKYDAGRDDRKKETPQNENNSERSPVQVG
ASEEEECPPNIHTFPTTNHTAKKQSNAILKYSTNDFILXAQYFITLPPVEAVAVADXPSPSELLVLEDGLAEVQPGKKSVAAEMNPDLNF
GFYDENASREEGELLHTQMHNQLSIGLEELVGX
Predicted Coding Sequence 
AGAGCATTAATTGATTCTGXTGTGCGCCCCTTTGTTTTGAGTCAGATCTTCTCGGAAGCCCATGCTGAAATAATGCAGGGGAGGCAGCAG
CATATTGTTGCACATAGAATAAATGGCATGGCATACCCXGATACAGCTAAAGGTCAGAAATACTATACACAACCTACGGATGAAAGAAAC
ATGAGCAAATATGATGCTGGTAGAGATGATAGAAAGAAGGAAACACCCCAAAATGAAAACAACAGTGAAAGATCACCTGTACAAGTTGGA
GCCTCAGAGGAAGAGGAGTGTCCGCCAAATATCCACACATTTCCAACCACAAACCACACTGCAAAAAAACAATCTAATGCCATTTTGAAG
TACTCAACAAATGATTTTATCCTTGXTGCTCAGTATTTCATTACTTTGCCACCTGTAGAAGCTGTAGCAGTTGCTGACGAXCCTTCACCT
TCTGAACTCCTTGTACTTGAGGATGGTCTGGCTGAAGTTCAACCTGGGAAGAAATCTGTGGCTGCTGAGATGAATCCTGATCTGAATTTT
GGTTTCTATGACGAAAACGCCAGTAGAGAAGAGGGAGAATTGCTACACACCCAGATGCATAACCAACTATCCATTGGGCTAGAGGAGCTC
GTGGGTGXX
Edits in Original Sequence 
(5')AGAGCATTAATTGATTCTGXTGTGCGCCCCTTTGTTTTGAGTCAGATCTTCTCGGAAGCCCATGaCTGAAATAATGCAGGGGAGGC
AGCAGCATATTGTTGCACATAGAATAAATGGCATGGCATACCCXGATACAGCTAAAGGTCAGAAATACTATACACAACCTACGGATGAAt
AGAAACATGAGCAAATATGATGCTGGTAGAGATGATAGAAAGtAAGGAAACACCCCAAAATGAAAACAACAGTGAAAGATCACCTGTACA
AGTTgGGAGCCTCAGAGGAAGAGGAGTGTCCGCCAAATATCCACACATTTCCAACCACAAACCACACTGCAAAAAAACAATCTAATGCCA
TTTTGAAGTACTCAACAAATGATTTTATCCTTGXTGCTCAGTATTTCATTACTTTGaCCACCTGTAGAAGCTGTAGCAGTTGtCTGACGA
XCCTTCACCTTCTGAACTCCTTGTACTTGAGGATGGTCTGGCTGAgAGTTCAACCTGGGAAGAAATCTGTGGCTGCTGAGATGAATCCTG
ATCTGAATTTTGGTTTCTATGACGAAAACGCCAGTAGAGAAGAGGGAGAATTGCTACACACCCAGATGCATAACCAACTATCCATTGGGC
TAGAGGAGCTCGTGGGTGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan