Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U595844

Score 
296
Direction 
Reverse
Predicted Peptide Sequence 
MTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKALAVSDSRPVPALHSSVDVRPLNKDDFKYAHEQVCASVSSESANMNELLQWNELYGE
GGSRKKKSLSYFM*
Predicted Coding Sequence 
ATGACTGAAGGGTATTCCGGAAGTGATTTAAAGAATTTATGTGTCACAGCTGCTCATTGCCCAATTAGAGAAATATTGGAGAAAGAGAAA
AAGGAAAAAGCATTGGCAGTTTCAGATAGCAGGCCAGTCCCTGCATTGCATAGTAGTGTGGACGTTCGCCCCCTTAACAAGGATGATTTT
AAATATGCACATGAACAGGTATGTGCTAGTGTATCTTCAGAATCGGCAAACATGAATGAGTTACTCCAGTGGAATGAATTGTATGGAGAA
GGTGGATCAAGGAAGAAGAAATCTCTCAGTTACTTCATGTAG
Edits in Original Sequence 
GCCAAATGTTTATTTGGAAGCTATAAGCAAAT(5')ATGACTGAAGGGTATTCCGGAAGTGATTTAAAGAATTTATGTGTCACAGCTGCT
CATTGCCCAATTAGAGAAATATTGGAGAAAGAGAAAAAGGAAAAAGCATTGGCAGTTTCAGATAGCAGGCCAGTCCCTGCATTGCATAGT
AGTGTGGACGTTCGCCCCCTTAACAAGGATGATTTTAAATATGCACATGAACAGGTATGTGCTAGTGTATCTTCAGAATCGGCAAACATG
AATGAGTTACTCCAGTGGAATGAATTGTATGGAGAAGGTGGATCAAGGAAGAAGAAATCTCTCAGTTACTTCATGTAG(3')AGACATGT
GAAGTGTATAGTGTTGCTTTATTTATTTACCCAAGTTGGTAGGGACGGGTCCTGCATGCATGGAAATCCATTTCAGGTTCCCTGGAGTCC
AAACCCCCAACCGCGGAAAACTGTGTATCATAGTTAGTTAATAGTTATGAAATATCTATCTATCCGAAGCTTGTCTTCCAATTTTCACCT
TATTGGATCTCCTCTGTATATACAATTTGATTTATTTAATAAATAAACATCCCCATGCTCTTTTTTGTTTTCCATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan